Density Regulated Protein (DENR) (NM_003677) Human Tagged ORF Clone

CAT#: RG203227

  • TrueORF®

DENR (tGFP-tagged) - Human density-regulated protein (DENR)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_003677" in other vectors (4)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DENR rabbit polyclonal antibody
    • 100 ul

USD 380.00

Other products for "Density Regulated Protein"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol Density Regulated Protein
Synonyms DRP; DRP1; SMAP-3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG203227 representing NM_003677
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCTGACATTTCTGAATCCAGCGGGGCTGACTGCAAAGGAGACCCAAGGAACAGTGCCAAGTTAG
ATGCCGATTACCCACTTCGAGTCCTTTATTGTGGAGTCTGTTCATTACCAACAGAGTACTGTGAATATAT
GCCTGATGTTGCTAAATGTAGACAATGGTTAGAGAAGAATTTTCCAAATGAATTTGCAAAACTTACTGTA
GAAAATTCACCCAAACAAGAAGCTGGAATTAGTGAGGGTCAAGGAACAGCAGGGGAAGAAGAGGAGAAGA
AAAAACAGAAGAGAGGTGGAAGGGGTCAAATAAAACAAAAAAAGAAGACCGTACCACAAAAGGTTACTAT
AGCCAAAATTCCCAGAGCAAAGAAGAAATATGTGACAAGAGTATGTGGCCTTGCAACTTTTGAAATTGAT
CTTAAAGAAGCACAAAGATTTTTTGCTCAAAAATTCTCCTGTGGTGCCTCAGTAACAGGGGAGGATGAAA
TTATCATTCAGGGAGATTTTACAGATGACATAATTGATGTCATTCAGGAAAAATGGCCAGAGGTAGATGA
TGACAGCATCGAAGATCTTGGAGAAGTAAAGAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203227 representing NM_003677
Red=Cloning site Green=Tags(s)

MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTV
ENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEID
LKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003677
ORF Size 594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003677.5
RefSeq Size 3061 bp
RefSeq ORF 597 bp
Locus ID 8562
UniProt ID O43583
Cytogenetics 12q24.31
Gene Summary This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.