RAB39B (NM_171998) Human Tagged ORF Clone

CAT#: RG202178

Reviews ()
Write a review
  • TrueORF®

RAB39B (GFP-tagged) - Human RAB39B, member RAS oncogene family (RAB39B)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 500.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol RAB39B
Synonyms BGMR; MRX72; WSMN; WSN
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG202178 representing NM_171998
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCCATCTGGCTGTACCAGTTCCGGCTCATTGTCATCGGGGATTCCACAGTGGGCAAGTCCTGCC
TGATCCGCCGCTTCACCGAGGGTCGCTTTGCCCAGGTTTCTGACCCCACCGTGGGGGTGGATTTTTTCTC
CCGCTTGGTGGAGATCGAGCCAGGAAAACGCATCAAGCTCCAGATCTGGGATACCGCGGGTCAAGAGAGG
TTCAGATCCATCACTCGCGCCTACTACAGGAACTCAGTAGGTGGTCTTCTCTTATTTGACATTACCAACC
GCAGGTCCTTCCAGAATGTCCATGAGTGGTTAGAAGAGACCAAAGTACACGTTCAGCCCTACCAAATTGT
ATTTGTTCTGGTGGGTCACAAGTGTGACCTGGATACACAGAGGCAAGTGACTCGCCACGAGGCCGAGAAA
CTGGCTGCTGCATACGGCATGAAGTACATTGAAACGTCAGCCCGAGATGCCATTAATGTGGAGAAAGCCT
TCACAGACCTGACAAGAGACATATATGAGCTGGTTAAAAGGGGGGAGATTACAATCCAGGAGGGCTGGGA
AGGGGTGAAGAGTGGATTTGTACCAAATGTGGTTCACTCTTCAGAAGAGGTTGTCAAATCAGAGAGGAGA
TGTTTGTGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG202178 representing NM_171998
Red=Cloning site Green=Tags(s)

MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQER
FRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEK
LAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERR
CLC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_171998
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_171998.4
RefSeq Size 3499 bp
RefSeq ORF 642 bp
Locus ID 116442
UniProt ID Q96DA2
Cytogenetics Xq28
Protein Families Druggable Genome
Gene Summary This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking. Mutations in this gene are associated with X-linked cognitive disability. [provided by RefSeq, Aug 2013]
Other products for "RAB39B"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.