SWAP70 (NM_015055) Human Tagged ORF Clone

CAT#: RG200074

Reviews ()
Write a review
  • TrueORF®

SWAP70 (GFP-tagged) - Human SWAP switching B-cell complex 70kDa subunit (SWAP70)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 745.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol SWAP70
Synonyms HSPC321; SWAP-70
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG200074 representing NM_015055
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAGCTTGAAGGAGGAGCTGCTCAAAGCCATCTGGCACGCCTTCACCGCACTCGACCAGGACCACA
GCGGCAAGGTCTCCAAGTCCCAGCTCAAGGTCCTTTCCCATAACCTGTGCACGGTGCTGAAGGTTCCTCA
TGACCCAGTTGCCCTTGAAGAGCACTTCAGGGATGATGATGAGGGTCCAGTGTCCAACCAGGGCTACATG
CCTTATTTAAACAGGTTCATTTTGGAAAAGGTCCAAGACAACTTTGACAAGATTGAATTCAATAGGATGT
GTTGGACCCTCTGTGTCAAAAAAAACCTCACAAAGAATCCCCTGCTCATTACAGAAGAAGATGCATTTAA
AATATGGGTTATTTTCAACTTTTTATCTGAGGACAAGTATCCATTAATTATTGTGTCAGAAGAGATTGAA
TACCTGCTTAAGAAGCTTACAGAAGCTATGGGAGGAGGTTGGCAGCAAGAACAATTTGAACATTATAAAA
TCAACTTTGATGACAGTAAAAATGGCCTTTCTGCATGGGAACTTATTGAGCTTATTGGAAATGGACAGTT
TAGCAAAGGCATGGACCGGCAGACTGTGTCTATGGCAATTAATGAAGTCTTTAATGAACTTATATTAGAT
GTGTTAAAGCAGGGTTACATGATGAAAAAGGGCCACAGACGGAAAAACTGGACTGAAAGATGGTTTGTAC
TAAAACCCAACATAATTTCTTACTATGTGAGTGAGGATCTGAAGGATAAGAAAGGAGACATTCTCTTGGA
TGAAAATTGCTGTGTAGAGTCCTTGCCTGACAAAGATGGAAAGAAATGCCTTTTTCTCGTAAAATGTTTT
GATAAGACTTTTGAAATCAGTGCTTCAGATAAGAAGAAGAAACAGGAGTGGATTCAAGCCATTCATTCTA
CTATTCATCTGTTGAAGCTGGGCAGCCCTCCACCACACAAAGAAGCCCGCCAGCGTCGGAAAGAACTCCG
GAAGAAGCAGCTGGCTGAACAAGAGGAACTGGAGCGACAAATGAAGGAACTCCAGGCCGCCAACGAAAGC
AAGCAGCAGGAGCTGGAGGCCGTGCGGAAGAAACTGGAGGAAGCAGCATCTCGTGCAGCAGAAGAGGAAA
AGAAACGCCTTCAGACTCAAGTGGAACTTCAGGCCAGGTTCAGCACAGAGCTGGAAAGAGAGAAGCTTAT
CAGACAGCAGATGGAAGAACAGGTTGCTCAAAAGTCCTCTGAACTGGAACAGTATTTACAGCGAGTACGG
GAGCTGGAAGACATGTACCTAAAGCTGCAGGAGGCTCTTGAAGATGAGAGACAGGCCCGGCAAGATGAAG
AGACAGTGCGGAAGCTTCAGGCCAGGTTGTTGGAGGAAGAGTCTTCCAAGAGGGCTGAACTAGAAAAGTG
GCACTTGGAGCAGCAGCAGGCCATTCAGACAACCGAGGCGGAGAAGCAGGAGTTGGAGAATCAGCGTGTC
CTGAAGGAACAGGCCCTGCAGGAGGCCATGGAGCAGCTGGAGCAGCTTGAGTTAGAACGGAAGCAAGCAC
TTGAGCAGTACGAGGAAGTTAAAAAGAAGCTGGAGATGGCAACTAATAAGACCAAGAGCTGGAAGGACAA
AGTGGCCCATCATGAAGGATTAATTCGACTGATAGAACCAGGTTCAAAGAACCCTCACCTGATCACTAAC
TGGGGACCTGCAGCTTTCACTGAGGCAGAACTTGAAGAGAGAGAGAAGAACTGGAAAGAGAAAAAGACCA
CGGAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200074 representing NM_015055
Red=Cloning site Green=Tags(s)

MGSLKEELLKAIWHAFTALDQDHSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDDEGPVSNQGYM
PYLNRFILEKVQDNFDKIEFNRMCWTLCVKKNLTKNPLLITEEDAFKIWVIFNFLSEDKYPLIIVSEEIE
YLLKKLTEAMGGGWQQEQFEHYKINFDDSKNGLSAWELIELIGNGQFSKGMDRQTVSMAINEVFNELILD
VLKQGYMMKKGHRRKNWTERWFVLKPNIISYYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLVKCF
DKTFEISASDKKKKQEWIQAIHSTIHLLKLGSPPPHKEARQRRKELRKKQLAEQEELERQMKELQAANES
KQQELEAVRKKLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVR
ELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAIQTTEAEKQELENQRV
LKEQALQEAMEQLEQLELERKQALEQYEEVKKKLEMATNKTKSWKDKVAHHEGLIRLIEPGSKNPHLITN
WGPAAFTEAELEEREKNWKEKKTTE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015055
ORF Size 1755 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015055.4
RefSeq Size 4848 bp
RefSeq ORF 1758 bp
Locus ID 23075
UniProt ID Q9UH65
Cytogenetics 11p15.4
Gene Summary Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. It also mediates signaling of membrane ruffling. Regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion (By similarity).[UniProtKB/Swiss-Prot Function]
Other products for "SWAP70"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.