DOK7 (NM_001256896) Human Tagged ORF Clone

CAT#: RC233217

  • TrueORF®

DOK7 (Myc-DDK tagged) - Homo sapiens docking protein 7 (DOK7), transcript variant 3

ORF Plasmid: DDK tGFP


  "NM_001256896" in other vectors (2)

Reconstitution Protocol

USD 330.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


DOK7 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
    • 100 ul

USD 447.00

Other products for "DOK7"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DOK7
Synonyms C4orf25; CMS1B; CMS10; FADS3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC233217 representing NM_001256896
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGGTGCCTCAAGGCCACCCCCCAAGCCGCTGCGTCCGCGGCAGCTGCAGGAGGTTGGCCGCCAGA
GCTCCTCGGACAGCGGCATCGCCACTGGCAGCCACTCCTCTTACTCCAGCAGCCTCTCGTCCTACGCGGG
CAGCAGCCTGGACGTGTGGCGGGCCACAGATGAACTGGGCTCACTGCTCAGCCTGCCAGCAGCGGGGGCC
CCCGAGCCCAGCCTGTGCACCTGCCTGCCCGGGACAGTCGAGTACCAGGTGCCCACCTCCCTGCGGGCCC
ACTATGACACACCACGCAGCCTTTGCCTGGCTCCTAGAGACCACAGCCCCCCCTCACAGGGCAGCCCCGG
CAACAGTGCGGCCAGGGACTCAGGCGGCCAGACGTCCGCCGGGTGTCCCTCTGGCTGGCTGGGCACGAGA
CGGCGGGGCCTGGTGATGGAGGCCCCCCAGGGCAGCGAGGCCACACTGCCTGGCCCTGCCCCTGGCGAGC
CCTGGGAAGCAGGCGGCCCCCACGCGGGGCCACCCCCGGCTTTCTTTTCGGCATGTCCAGTCTGTGGAGG
ACTCAAGGTAAACCCCCCTCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC233217 representing NM_001256896
Red=Cloning site Green=Tags(s)

MVGASRPPPKPLRPRQLQEVGRQSSSDSGIATGSHSSYSSSLSSYAGSSLDVWRATDELGSLLSLPAAGA
PEPSLCTCLPGTVEYQVPTSLRAHYDTPRSLCLAPRDHSPPSQGSPGNSAARDSGGQTSAGCPSGWLGTR
RRGLVMEAPQGSEATLPGPAPGEPWEAGGPHAGPPPAFFSACPVCGGLKVNPPP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001256896
ORF Size 582 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001256896.1, NP_001243825.1
RefSeq Size 2281 bp
RefSeq ORF 585 bp
Locus ID 285489
UniProt ID Q18PE1
Cytogenetics 4p16.3
MW 20.2 kDa
Gene Summary The protein encoded by this gene is essential for neuromuscular synaptogenesis. The protein functions in aneural activation of muscle-specific receptor kinase, which is required for postsynaptic differentiation, and in the subsequent clustering of the acetylcholine receptor in myotubes. This protein can also induce autophosphorylation of muscle-specific receptor kinase. Mutations in this gene are a cause of familial limb-girdle myasthenia autosomal recessive, which is also known as congenital myasthenic syndrome type 1B. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.