CHFR (NM_001161344) Human Tagged ORF Clone

CAT#: RC228526

Reviews ()
Write a review

CHFR (Myc-DDK-tagged)-Human checkpoint with forkhead and ring finger domains (CHFR), transcript variant 1



Reconstitution Protocol

USD 618.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "CHFR"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CHFR
Synonyms RNF116; RNF196
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC228526 representing NM_001161344
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCGGCCCGAGGAAGGCAAGCAGTCGCCGCCGCCGCAGCCCTGGGGACGGCTCCTGCGTCTGGGCG
CGGAGGAGGGCGAGCCGCACGTCCTCCTGAGGAAGCGGGAGTGGACCATCGGGCGGAGACGAGGTTGCGA
CCTTTCCTTCCCCAGCAATAAACTGGTCTCTGGAGATCACTGTAGAATTGTAGTGGATGAAAAATCAGGT
CAGGTGACACTGGAAGATACCAGCACCAGTGGAACAGTGATTAACAAGCTGAAGGTTGTTAAGAAGCAGA
CATGCCCTTTACAGACTGGGGATGTCATCTACTTGGTGTACAGGAAGAATGAACCGGAACACAACGTGGC
ATACCTCTATGAATCTTTAAGTGAAAAGCAAGGCATGACACAAGAATCCTTTGAAGCTAACAAGGAAAAT
GTGTTCCATGGGACCAAAGATACCTCAGGTGCAGGTGCAGGGCGAGGGGCCGATCCCCGGGTCCCTCCGT
CGTCGCCCGCCACTCAGGTGTGCTTTGAGGAACCACAGCCATCAACATCGACGTCAGACCTCTTCCCCAC
AGCCTCGGCCTCTTCCACGGAGCCTTCTCCTGCAGGGCGAGAGCGTTCCTCCAGTTGTGGGTCTGGGGGT
GGTGGCATCTCCCCTAAAGGAAGTGGTCCCTCTGTGGCAAGTGATGAAGTCTCCAGCTTTGCCTCAGCTC
TCCCAGACAGAAAGACTGCGTCCTTTTCGTCGTTGGAACCCCAGGATCAGGAGGATTTGGAGCCCGTGAA
GAAGAAAATGAGAGGAGATGGGGACCTTGACCTGAACGGGCAGTTGTTGGTCGCACAACCGCGTAGAAAT
GCCCAAACCGTCCACGAGGACGTCAGAGCAGCGGCTGGGAAGCCAGACAAGATGGAGGAGACGCTGACAT
GCATCATCTGCCAGGACCTGCTGCACGACTGCGTGAGTTTGCAGCCCTGCATGCACACGTTCTGCGCGGC
TTGCTACTCGGGCTGGATGGAGCGCTCGTCCCTGTGTCCTACCTGCCGCTGTCCCGTGGAGCGGATCTGT
AAAAACCACATCCTCAACAACCTCGTGGAAGCATACCTCATCCAGCATCCAGACAAGAGTCGCAGTGAAG
AAGATGTGCAAAGTATGGATGCCAGGAATAAAATCACTCAAGACATGCTGCAGCCCAAAGTCAGGCGGTC
TTTTTCTGATGAAGAAGGGAGTTCAGAGGACCTGCTGGAGCTGTCAGACGTTGACAGTGAGTCCTCAGAC
ATTAGCCAGCCATACGTCGTGTGCCGGCAGTGTCCTGAGTACAGAAGGCAGGCGGCGCAGCCTCCCCACT
GCCCAGCACCCGAGGGCGAGCCAGGAGCCCCACAGGCCCTGGGGGATGCACCCTCCACGTCCGTCAGCCT
GACGACAGCAGTCCAGGATTACGTGTGCCCTCTGCAAGGAAGCCACGCCCTGTGCACCTGCTGCTTCCAG
CCCATGCCCGACCGGAGAGCGGAGCGCGAGCAGGACCCGCGTGTCGCCCCTCAGCAGTGTGCGGTCTGCC
TGCAGCCTTTCTGCCACCTGTACTGGGGCTGCACCCGGACCGGCTGCTACGGCTGCCTGGCCCCGTTTTG
TGAGCTCAACCTGGGTGACAAGTGTCTGGACGGCGTGCTGAACAACAACAGCTACGAGTCAGACATCCTG
AAGAATTACCTGGCAACCAGAGGTTTGACATGGAAAAACATGTTGACCGAGAGCCTCGTGGCTCTCCAGC
GGGGAGTGTTTCTGCTGTCTGATTACAGAGTCACGGGAGACACCGTTCTGTGTTACTGCTGTGGCCTGCG
CAGCTTCCGTGAGCTGACCTATCAGTATCGGCAGAACATTCCTGCTTCCGAGTTGCCAGTGGCCGTAACA
TCCCGTCCTGACTGCTACTGGGGCCGTAACTGCCGCACTCAGGTGAAAGCTCACCACGCCATGAAATTCA
ATCATATCTGTGAACAGACAAGGTTCAAAAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC228526 representing NM_001161344
Red=Cloning site Green=Tags(s)

MERPEEGKQSPPPQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSG
QVTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLYESLSEKQGMTQESFEANKEN
VFHGTKDTSGAGAGRGADPRVPPSSPATQVCFEEPQPSTSTSDLFPTASASSTEPSPAGRERSSSCGSGG
GGISPKGSGPSVASDEVSSFASALPDRKTASFSSLEPQDQEDLEPVKKKMRGDGDLDLNGQLLVAQPRRN
AQTVHEDVRAAAGKPDKMEETLTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERIC
KNHILNNLVEAYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSD
ISQPYVVCRQCPEYRRQAAQPPHCPAPEGEPGAPQALGDAPSTSVSLTTAVQDYVCPLQGSHALCTCCFQ
PMPDRRAEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDIL
KNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVT
SRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFKN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001161344
ORF Size 1992 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001161344.1, NP_001154816.1
RefSeq ORF 1995 bp
Locus ID 55743
UniProt ID Q96EP1
Cytogenetics 12q24.33
Protein Families Druggable Genome
MW 73.2 kDa
Gene Summary This gene encodes an E3 ubiquitin-protein ligase required for the maintenance of the antephase checkpoint that regulates cell cycle entry into mitosis and, therefore, may play a key role in cell cycle progression and tumorigenesis. The encoded protein has an N-terminal forkhead-associated domain, a central RING-finger domain, and a cysteine-rich C-terminal region. Alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Mar 2014]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.