DAGLB (NM_001142936) Human Tagged ORF Clone

CAT#: RC226682

DAGLB (Myc-DDK-tagged)-Human diacylglycerol lipase, beta (DAGLB), transcript variant 2

Clone Modification / Custom Cloning Service

USD 701.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DAGLB (NM_001142936) Human Tagged ORF Clone
Symbol DAGLB
Synonyms DAGLBETA; KCCR13L
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC226682 representing NM_001142936
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGGGATGGTACTCTTCGGCCGGCGCTGGGCCATCGCCAGCGACGACTTGGTCTTCCCAGGGTTCT
TCGAGCTGGTCGTGCGAGTGCTGTGGTGGATTGGCATTCTGACGTTGTATCTCATGCACAGAGGAAAGCT
GGACTGTGCTGGTGGAGCCTTGCTCAGCAGTTACTTGATCGTCCTCATGATTCTCCTGGCAGTTGTCATA
TGTACTGTGTCAGCCATCATGTGTGTCAGCATGAGAGGAACGATTTGTAACCCTGGACCGCGGAAGTCTA
TGTCTAAGCTGCTTTACATCCGCCTGGCGCTGTTTTTTCCAGAGATGGTCTGGGCCTCTCTGGGGGCTGC
CTGGGTGGCAGATGGTGTTCAGTGCGACAGGACAGTTGTAAACGGCATCATCGCAACCGTCGTGGTCAGG
ACACAGATCTGGTGCCCAGCGACATTGCGGCGGGCCTCGCCCTGCTTCATCAGCAACAGGACAATATCAG
GAACAACCAAGAGCCTGCCCAGGTGGTCTGCCATGCCCCAGGGAGCTCCCAGCTGCAGAAGCAGAACCAC
AGACTATGACTTGGTCGGAGGCGATCAGCTCAACTGTCACTTCGGCTCCATCCTGCACACCACAGGGCTG
CAGTACAGGGACTTCATCCACGTCAGCTTCCATGACAAGGTTTACGAGCTGCCGTTTTTAGTGGCTCTGG
ATCACAGGAAAGAGTCTGTTGTGGTCGCTGTGAGGGGGACCATGTCTCTGCAGGATGTCCTTACGGACCT
GTCAGCGGAGAGTGAGGTGCTGGACGTGGAGTGTGAGGTGCAGGACCGCCTGGCACACAAGGGTATTTCT
CAAGCTGCCAGATACGTTTACCAACGACTCATCAACGACGGGATTTTGAGCCAAGCCTTCAGCATTGCTC
CTGAGTACCGGCTGGTCATAGTGGGCCACAGCCTCGGGGGCGGGGCGGCCGCCCTGCTGGCCACCATGCT
CAGAGCCGCCTACCCGCAGGTCAGGTGCTACGCCTTCTCCCCACCCCGGGGGCTGTGGAGCAAAGCTCTG
CAGGAATATTCTCAGAGCTTCATCGTGTCACTCGTCCTGGGGAAGGATGTGATTCCCAGGCTCAGTGTGA
CCAACTTGGAAGATCTGAAGAGAAGAATCTTGCGAGTGGTCGCGCACTGCAATAAACCCAAGTACAAGAT
CTTGCTGCACGGTTTGTGGTACGAACTGTTTGGAGGAAACCCCAACAACTTGCCCACGGAGCTGGACGGG
GGCGACCAGGAAGTCCTGACACAGCCTCTTCTGGGGGAGCAGAGCCTACTGACGCGCTGGTCCCCGGCCT
ACAGCTTCTCCAGCGACTCCCCACTGGACTCTTCTCCCAAGTACCCCCCTCTCTACCCTCCCGGCAGGAT
CATCCACCTGCAGGAGGAGGGCGCCTCGGGGCGGTTTGGCTGCTGCTCTGCTGCTCACTATAGCGCCAAG
TGGTCACACGAAGCGGAATTCAGCAAAATACTCATAGGTCCGAAGATGCTCACCGACCACATGCCAGACA
TCCTGATGCGGGCCTTGGACAGCGTGGTCTCCGACAGAGCGGCCTGCGTCTCCTGTCCAGCACAAGGGGT
CTCCAGTGTGGACGTGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC226682 representing NM_001142936
Red=Cloning site Green=Tags(s)

MPGMVLFGRRWAIASDDLVFPGFFELVVRVLWWIGILTLYLMHRGKLDCAGGALLSSYLIVLMILLAVVI
CTVSAIMCVSMRGTICNPGPRKSMSKLLYIRLALFFPEMVWASLGAAWVADGVQCDRTVVNGIIATVVVR
TQIWCPATLRRASPCFISNRTISGTTKSLPRWSAMPQGAPSCRSRTTDYDLVGGDQLNCHFGSILHTTGL
QYRDFIHVSFHDKVYELPFLVALDHRKESVVVAVRGTMSLQDVLTDLSAESEVLDVECEVQDRLAHKGIS
QAARYVYQRLINDGILSQAFSIAPEYRLVIVGHSLGGGAAALLATMLRAAYPQVRCYAFSPPRGLWSKAL
QEYSQSFIVSLVLGKDVIPRLSVTNLEDLKRRILRVVAHCNKPKYKILLHGLWYELFGGNPNNLPTELDG
GDQEVLTQPLLGEQSLLTRWSPAYSFSSDSPLDSSPKYPPLYPPGRIIHLQEEGASGRFGCCSAAHYSAK
WSHEAEFSKILIGPKMLTDHMPDILMRALDSVVSDRAACVSCPAQGVSSVDVA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001142936
ORF Size 1629 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001142936.1, NP_001136408
RefSeq ORF 1632
Locus ID 221955
Cytogenetics 7p22.1
Protein Families Transmembrane
MW 59.7 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)