Sialoadhesin (SIGLEC1) (NM_023068) Human Tagged ORF Clone

CAT#: RC224969

Reviews ()
Write a review

SIGLEC1 (Myc-DDK-tagged)-Human sialic acid binding Ig-like lectin 1, sialoadhesin (SIGLEC1)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,689.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SIGLEC1
Synonyms CD169; SIGLEC-1; SN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC224969 representing NM_023068.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGGCTTCTTGCCCAAGCTTCTCCTCCTGGCCTCATTCTTCCCAGCAGGCCAGGCCTCATGGGGCGTC
TCCAGTCCCCAGGACGTGCAGGGTGTGAAGGGGTCTTGCCTGCTTATCCCCTGCATCTTCAGCTTCCCT
GCCGACGTGGAGGTGCCCGACGGCATCACGGCCATCTGGTACTACGACTACTCGGGCCAGCGGCAGGTG
GTGAGCCACTCGGCGGACCCCAAGCTGGTGGAGGCCCGCTTCCGCGGCCGCACCGAGTTCATGGGGAAC
CCCGAGCACAGGGTGTGCAACCTGCTGCTGAAGGACCTGCAGCCCGAGGACTCTGGTTCCTACAACTTC
CGCTTCGAGATCAGTGAGGTCAACCGCTGGTCAGATGTGAAAGGCACCTTGGTCACAGTAACAGAGGAG
CCCAGGGTGCCCACCATTGCCTCCCCGGTGGAGCTT

CTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATTACAAGGATGACGAC
GATAAG
GTTTAAACGGCCGGCCGCGGTCATAGCTGT
>Peptide sequence encoded by RC224969
Blue=ORF Red=Cloning site Green=Tag(s)

MGFLPKLLLLASFFPAGQASWGVSSPQDVQGVKGSCLLIPCIFSFPADVEVPDGITAIWYYDYSGQRQV
VSHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEISEVNRWSDVKGTLVTVTEE
PRVPTIASPVEL

LEQKLISEEDLAANDILDYKDDDDKV

Recombinant protein using RC224969 also available, TP324969M
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-XhoI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_023068
ORF Size 5127 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq Size 5130 bp
RefSeq ORF 5130 bp
Locus ID 6614
UniProt ID Q9BZZ2
Cytogenetics 20p13
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs)
MW 182.7 kDa
Gene Summary This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a lectin-like adhesion molecule that binds glycoconjugate ligands on cell surfaces in a sialic acid-dependent manner. It is a type I transmembrane protein expressed only by a subpopulation of macrophages and is involved in mediating cell-cell interactions. Alternative splicing produces a transcript variant encoding an isoform that is soluble rather than membrane-bound; however, the full-length nature of this variant has not been determined. [provided by RefSeq, Jul 2008]
Other products for "SIGLEC1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.