POLR2J2 (NM_032959) Human Tagged ORF Clone
CAT#: RC224755
POLR2J2 (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2)
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_032959" in other vectors (4)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | POLR2J2 |
Synonyms | HRPB11B; POLR2J3; RPB11b1; RPB11b2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC224755 representing NM_032959
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAACGCCCCTCCAGCCTTCGAGTCGTTCTTGCTCTTCGAGGGCGAGAAGATCACCATTAACAAGGACA CCAAGGTACCCAATGCCTGTTTATTCACCATGAACAAAGAAGACCACACACTGGGAAACATCATTAAATC ACAACTCCTAAAAGACCCGCAAGTGCTATTTGCTGGCTACAAAGTCCCCCACCCCTTGGAGCACAAGATC ATCATCCGAGTGCAGACCACGCCGGACTACAGCCCCCAGGAAGCCTTTACCAACGCCATCACCGACCTCA TCAGCGAGCTGTCCCTGCTGGAGGAGCGCTTCCGGACGTGCCTGCTTCCCCTTCGCCTTCTGCCG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC224755 representing NM_032959
Red=Cloning site Green=Tags(s) MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKI IIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_032959 |
ORF Size | 345 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_032959.1 |
RefSeq Size | 1727 bp |
RefSeq ORF | 348 bp |
Locus ID | 246721 |
UniProt ID | Q9GZM3 |
Cytogenetics | 7q22.1 |
Domains | RNA_pol_L |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
MW | 12.9 kDa |
Gene Summary | This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC224755L3 | Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2), Myc-DDK-tagged |
USD 450.00 |
|
RC224755L4 | Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2), mGFP tagged |
USD 450.00 |
|
RG224755 | POLR2J2 (tGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2) |
USD 350.00 |
|
SC110811 | POLR2J2 (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2) |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review