Hyaluronan synthase 2(HAS2) (NM_005328) Human Tagged ORF Clone

CAT#: RC224227

HAS2 (Myc-DDK-tagged)-Human hyaluronan synthase 2 (HAS2)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Hyaluronan synthase 2(HAS2) (NM_005328) Human Tagged ORF Clone
Symbol HAS2
Synonyms MGC126241; MGC126242
Vector pCMV6-Entry
Sequence Data
>RC224227 representing NM_005328
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCATTGTGAGAGGTTTCTATGTATCCTGAGAATAATTGGAACCACACTCTTTGGAGTCTCTCTCCTCC
TTGGAATCACAGCTGCTTATATTGTTGGCTACCAGTTTATCCAAACGGATAATTACTATTTCTCTTTTGG
ACTGTATGGTGCCTTTTTGGCATCACACCTCATCATCCAAAGCCTGTTTGCCTTTTTGGAGCACCGAAAA
ATGAAAAAATCCCTAGAAACCCCCATAAAGTTGAACAAAACAGTTGCCCTTTGCATCGCTGCCTATCAAG
AAGATCCAGACTACTTAAGGAAATGTTTGCAATCTGTGAAAAGGCTAACCTACCCTGGGATTAAAGTTGT
CATGGTCATAGATGGGAACTCAGAAGATGACCTTTACATGATGGACATCTTCAGTGAAGTCATGGGCAGA
GACAAATCAGCCACTTATATCTGGAAGAACAACTTCCACGAAAAGGGTCCCGGTGAGACAGATGAGTCAC
ATAAAGAAAGCTCGCAACACGTAACGCAATTGGTCTTGTCCAACAAAAGTATCTGCATCATGCAAAAATG
GGGTGGAAAAAGAGAAGTCATGTACACAGCCTTCAGAGCACTGGGACGAAGTGTGGATTATGTACAGGTT
TGTGATTCAGACACTATGCTTGACCCAGCCTCATCTGTGGAGATGGTAAAAGTTTTAGAAGAAGATCCCA
TGGTTGGAGGTGTTGGGGGAGATGTCCAGATTTTAAACAAGTACGATTCCTGGATCTCATTCCTCAGCAG
TGTAAGATATTGGATGGCTTTTAATATAGAAAGGGCCTGTCAGTCTTATTTTGGGTGTGTTCAGTGCATT
AGTGGACCTCTGGGAATGTACAGAAACTCCTTGTTGCATGAGTTTGTGGAAGATTGGTACAATCAAGAAT
TTATGGGCAACCAATGTAGCTTTGGTGATGACAGGCATCTCACGAACCGGGTGCTGAGCCTGGGCTATGC
AACAAAATACACAGCTCGATCTAAGTGCCTTACTGAAACACCTATAGAGTATCTCAGATGGCTAAACCAG
CAGACCCGTTGGAGCAAGTCCTACTTCCGAGAATGGCTGTACAATGCAATGTGGTTTCACAAACATCACT
TGTGGATGACCTACGAAGCGATTATCACTGGATTCTTTCCTTTCTTTCTCATTGCCACAGTAATCCAGCT
CTTCTACCGGGGTAAAATTTGGAACATTCTCCTCTTCTTGTTAACTGTCCAGCTAGTAGGTCTCATAAAA
TCATCTTTTGCCAGCTGCCTTAGAGGAAATATCGTCATGGTCTTCATGTCTCTCTACTCAGTGTTATACA
TGTCGAGTTTACTTCCCGCCAAGATGTTTGCAATTGCAACAATAAACAAAGCTGGGTGGGGCACATCAGG
AAGGAAAACCATTGTTGTTAATTTCATAGGACTCATTCCAGTATCAGTTTGGTTTACAATCCTCCTGGGT
GGTGTGATTTTCACCATTTATAAGGAGTCTAAAAGGCCATTTTCAGAATCCAAACAGACAGTTCTAATTG
TTGGAACGTTGCTCTATGCATGCTATTGGGTCATGCTTTTGACGCTGTATGTAGTTCTCATCAATAAGTG
TGGCAGGCGGAAGAAGGGACAACAATATGACATGGTGCTTGATGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224227 representing NM_005328
Red=Cloning site Green=Tags(s)

MHCERFLCILRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAFLASHLIIQSLFAFLEHRK
MKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGR
DKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQV
CDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCI
SGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQ
QTRWSKSYFREWLYNAMWFHKHHLWMTYEAIITGFFPFFLIATVIQLFYRGKIWNILLFLLTVQLVGLIK
SSFASCLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIPVSVWFTILLG
GVIFTIYKESKRPFSESKQTVLIVGTLLYACYWVMLLTLYVVLINKCGRRKKGQQYDMVLDV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005328
ORF Size 1656 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005328.1, NM_005328.2, NP_005319
RefSeq Size 3003
RefSeq ORF 1659
Locus ID 3037
Cytogenetics 8q24.13
Domains Glycos_transf_2
Protein Families Transmembrane, Druggable Genome
MW 63.4 kDa
Gene Summary Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. HA is synthesized by membrane-bound synthase at the inner surface of the plasma membrane, and the chains are extruded through pore-like structures into the extracellular space. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. Changes in the serum concentration of HA are associated with inflammatory and degenerative arthropathies such as rheumatoid arthritis. In addition, the interaction of HA with the leukocyte receptor CD44 is important in tissue-specific homing by leukocytes, and overexpression of HA receptors has been correlated with tumor metastasis. HAS2 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to glycosaminoglycan synthetase (DG42) from Xenopus laevis, and human and murine hyaluronan synthase 1. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)