PADI2 (NM_007365) Human Tagged ORF Clone

CAT#: RC223889

Reviews ()
Write a review

PADI2 (Myc-DDK-tagged)-Human peptidyl arginine deiminase, type II (PADI2)



  "NM_007365" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PADI2
Synonyms PAD-H19; PAD2; PDI2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC223889 representing NM_007365
Red=Cloning site Blue=ORF Green=Tags(s)

CTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCCGGCGC
GCC
C

ATGCTGCGCGAGCGGACCGTGCGGCTGCAGTACGGGAGCCGCGTGGAGGCGGTGTACGTGCTGGGCACCT
ACCTCTGGACCGATGTCTACAGCGCGGCCCCAGCCGGGGCCCAAACCTTCAGCCTGAAGCACTCGGAACA
CGTGTGGGTGGAGGTGGTGCGTGATGGGGAGGCTGAGGAGGTGGCCACCAATGGCAAGCAGCGCTGGCTT
CTCTCGCCCAGCACCACCCTGCGGGTCACCATGAGCCAGGCGAGCACCGAGGCCAGCAGTGACAAGGTCA
CCGTCAACTACTATGACGAGGAAGGGAGCATTCCCATCGACCAGGCGGGGCTCTTCCTCACAGCCATTGA
GATCTCCCTGGATGTGGACGCAGACCGGGATGGTGTGGTGGAGAAGAACAACCCAAAGAAGGCATCCTGG
ACCTGGGGCCCCGAGGGCCAGGGGGCCATCCTGCTGGTGAACTGTGACCGAGAGACACCCTGGTTGCCCA
AGGAGGACTGCCGTGATGAGAAGGTCTACAGCAAGGAAGATCTCAAGGACATGTCCCAGATGATCCTGCG
GACCAAAGGCCCCGACCGCCTCCCCGCCGGATACGAGATAGTTCTGTACATTTCCATGTCAGACTCAGAC
AAAGTGGGCGTGTTCTACGTGGAGAACCCGTTCTTCGGCCAACGCTATATCCACATCCTGGGCCGGCGGA
AGCTCTACCATGTGGTCAAGTACACGGGTGGCTCCGCGGAGCTGCTGTTCTTCGTGGAAGGCCTCTGTTT
CCCCGACGAGGGCTTCTCAGGCCTGGTCTCCATCCATGTCAGCCTGCTGGAGTACATGGCCCAGGACATT
CCCCTGACTCCCATCTTCACGGACACCGTGATATTCCGGATTGCTCCGTGGATCATGACCCCCAACATCC
TGCCTCCCGTGTCGGTGTTTGTGTGCTGCATGAAGGATAATTACCTGTTCCTGAAAGAGGTGAAGAACCT
TGTGGAGAAAACCAACTGTGAGCTGAAGGTCTGCTTCCAGTACCTAAACCGAGGCGATCGCTGGATCCAG
GATGAAATTGAGTTTGGCTACATCGAGGCCCCCCATAAAGGCTTCCCCGTGGTGCTGGACTCTCCCCGAG
ATGGAAACCTAAAGGACTTCCCTGTGAAGGAGCTCCTGGGCCCAGATTTTGGCTACGTGACCCGGGAGCC
CCTCTTTGAGTCTGTCACCAGCCTTGACTCATTTGGAAACCTGGAGGTCAGTCCCCCAGTGACCGTGAAT
GGCAAGACATACCCGCTTGGCCGCATCCTCATCGGGAGCAGCTTTCCTCTGTCTGGTGGTCGGAGGATGA
CCAAGGTGGTGCGTGACTTCCTGAAGGCCCAGCAGGTGCAGGCACCCGTGGAGCTCTACTCAGACTGGCT
GACTGTGGGCCACGTGGATGAGTTCATGTCCTTTGTCCCCATCCCCGGCACAAAGAAATTCCTGCTACTC
ATGGCCAGCACCTCGGCCTGCTACAAGCTCTTCCGAGAGAAGCAGAAGGACGGCCATGGAGAGGCCATCA
TGTTCAAAGGCTTGGGTGGGATGAGCAGCAAGCGAATCACCATCAACAAGATTCTGTCCAACGAGAGCCT
TGTGCAGGAGAACCTGTACTTCCAGCGCTGCCTAGACTGGAACCGTGACATCCTCAAGAAGGAGCTGGGA
CTGACAGAGCAGGACATCATTGACCTGCCCGCTCTGTTCAAGATGGACGAGGACCACCGTGCCAGAGCCT
TCTTCCCAAACATGGTGAACATGATCGTGCTGGACAAGGACCTGGGCATCCCCAAGCCATTCGGGCCACA
GGTTGAGGAGGAATGCTGCCTGGAGATGCACGTGCGTGGCCTCCTGGAGCCCCTGGGCCTCGAATGCACC
TTCATCGACGACATTTCTGCCTACCACAAATTTCTGGGGGAAGTCCACTGTGGCACCAACGTCCGCAGGA
AGCCCTTCACCTTCAAGTGGTGGCACATGGTGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223889 representing NM_007365
Red=Cloning site Green=Tags(s)

MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWL
LSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASW
TWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSD
KVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDI
PLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQ
DEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVPIPGTKKFLLL
MASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQENLYFQRCLDWNRDILKKELG
LTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGIPKPFGPQVEEECCLEMHVRGLLEPLGLECT
FIDDISAYHKFLGEVHCGTNVRRKPFTFKWWHMVP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites AscI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007365
ORF Size 1995 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007365.3
RefSeq Size 2348 bp
RefSeq ORF 1998 bp
Locus ID 11240
UniProt ID Q9Y2J8
Cytogenetics 1p36.13
Domains PAD
MW 75.4 kDa
Gene Summary This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "PADI2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-PADI2 Antibody
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.