ABL2 (NM_001100108) Human Tagged ORF Clone

CAT#: RC222989

ABL2 (Myc-DDK-tagged)-Human v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene) (ABL2), transcript variant c

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ABL2 (NM_001100108) Human Tagged ORF Clone
Symbol ABL2
Synonyms ABLL; ARG; FLJ22224; FLJ31718; FLJ41441
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC222989 representing NM_001100108
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCCTTGGGACAGTTCTCCTTCCACCTAATAGTTATGGCAGAGATCAGGACACTTCACTTTGCTGCC
TGTGCACTGAGGCCTCAGAATCTGCTCTACCCGACTTAACAGATCACTTTGCCAGCTGTGTGGAGGATGG
ATTTGAGGGAGACAAGACTGGAGGCAGTAGTCCAGAAGCTTTGCATCGTCCCTATGGTTGTGATGTTGAA
CCCCAGGCACTAAATGAGGCTATCAGGTGGAGCTCCAAGGAGAACTTGCTCGGAGCCACTGAGAGTGACC
CTAATCTCTTCGTTGCACTTTATGATTTTGTAGCAAGTGGTGATAACACACTCAGCATCACTAAAGGTGA
AAAGCTACGAGTCCTTGGTTACAACCAGAATGGTGAGTGGAGTGAAGTTCGCTCTAAGAATGGGCAGGGC
TGGGTGCCAAGCAACTACATCACCCCAGTGAACAGCCTGGAAAAACACTCCTGGTACCATGGACCTGTGT
CACGCAGTGCAGCTGAGTATCTGCTCAGCAGTCTAATCAATGGCAGCTTCCTGGTGCGAGAAAGTGAGAG
TAGCCCTGGGCAGCTGTCCATCTCGCTCAGGTACGAGGGACGTGTGTATCACTACAGGATCAATACCACT
GCAGATGGCAAGGTGTATGTGACTGCTGAGAGCCGCTTCAGCACCTTGGCAGAGCTTGTACACCATCACT
CCACAGTGGCTGATGGGCTGGTGACAACATTACACTACCCAGCACCCAAGTGTAATAAGCCTACAGTCTA
TGGTGTGTCCCCCATCCACGACAAATGGGAAATGGAGCGAACAGATATTACCATGAAGCACAAACTTGGG
GGCGGTCAGTATGGAGAGGTTTACGTTGGCGTCTGGAAGAAATACAGCCTTACAGTTGCTGTGAAAACAT
TGAAGGAAGATACCATGGAGGTAGAAGAATTCCTGAAAGAAGCTGCAGTAATGAAGGAAATCAAGCATCC
TAATCTGGTACAACTTTTAGGTGTGTGTACTTTGGAGCCACCATTTTACATTGTGACTGAATACATGCCA
TACGGGAATTTGCTGGATTACCTCCGAGAATGCAACCGAGAAGAGGTGACTGCAGTTGTGCTGCTCTACA
TGGCCACTCAGATTTCTTCTGCAATGGAGTACTTAGAGAAGAAGAATTTCATCCATAGAGATCTTGCAGC
TCGTAACTGCCTAGTGGGAGAAAACCATGTGGTAAAAGTGGCTGACTTTGGCTTAAGTAGATTGATGACT
GGAGACACTTATACTGCTCATGCTGGAGCCAAATTTCCTATTAAGTGGACAGCACCAGAGAGTCTTGCCT
ACAATACCTTCTCAATTAAATCTGACGTCTGGGCTTTTGGGGTATTGTTGTGGGAAATTGCTACCTATGG
AATGTCACCATATCCAGGTATTGACCTGTCTCAGGTCTATGACCTACTAGAAAAAGGATATCGAATGGAA
CAGCCTGAGGGATGCCCCCCTAAGGTTTATGAACTTATGAGAGCATGCTGGAAGTGGAGCCCTGCCGATA
GGCCCTCTTTTGCTGAAACACACCAAGCTTTTGAAACCATGTTCCATGACTCCAGCATTTCTGAAGAGGT
AGCTGAGGAGCTTGGGAGAGCCGCCTCCTCGTCATCTGTTGTTCCATACCTGCCCCGGCTACCTATACTT
CCTTCCAAGACTCGGACACTGAAGAAACAGGTGGAGAACAAGGAGAACATTGAAGGGGCACAAGATGCCA
CAGAAAATTCTGCTTCCAGTTTAGCACCAGGGTTCATCAGAGGTGCACAGGCCTCTAGTGGATCCCCAGC
ACTGCCTCGAAAGCAAAGAGACAAGTCACCCAGCAGCCTCTTGGAAGATGCCAAAGAGACATGCTTCACC
AGGGATAGGAAGGGGGGCTTCTTCAGCTCCTTCATGAAGAAGAGAAATGCTCCTACACCCCCCAAACGCA
GCAGCTCCTTCCGAGAAATGGAGAATCAGCCCCATAAGAAATACGAACTCACGGGTAACTTCTCATCTGT
TGCTTCTCTACAGCATGCTGATGGGTTCTCTTTCACTCCTGCCCAGCAAGAGGCGAATCTGGTGCCACCC
AAGTGCTATGGGGGGAGCTTTGCACAGAGGAACCTCTGTAATGACGACGGTGGTGGGGGTGGGGGCAGTG
GCACTGCTGGGGGTGGGTGGTCTGGCATCACAGGCTTCTTTACACCACGCTTAATCAAAAAGACACTGGG
CTTACGAGCAGGTAAACCCACAGCCAGTGATGACACTTCCAAGCCTTTTCCAAGGTCAAACTCTACATCT
TCCATGTCCTCAGGGCTTCCAGAGCAGGATAGGATGGCAATGACCCTTCCCAGGAACTGCCAGAGGTCCA
AACTCCAGCTGGAAAGGACAGTGTCCACCTCTTCTCAGCCAGAAGAGAATGTGGACAGGGCCAATGACAT
GCTTCCAAAAAAATCAGAGGAAAGTGCTGCTCCAAGCAGGGAGAGACCAAAAGCCAAGTTATTGCCCAGA
GGAGCCACAGCTCTTCCTCTCAGAACACCCTCTGGGGATCTAGCCATTACAGAGAAGGACCCTCCAGGGG
TGGGAGTGGCTGGAGTGGCAGCTGCCCCCAAGGGTAAAGAGAAGAATGGTGGGGCACGACTTGGGATGGC
TGGAGTTCCAGAGGATGGAGAGCAGCCGGGCTGGCCTTCTCCAGCCAAGGCTGCCCCCGTCCTCCCAACC
ACTCACAACCACAAAGTGCCAGTCCTTATCTCACCCACTCTGAAACACACTCCAGCTGACGTGCAGCTCA
TTGGCACAGACTCTCAGGGGAATAAATTCAAGCTCTTATCTGAGCATCAGGTCACATCCTCTGGAGACAA
GGACCGACCCCGACGGGTAAAACCAAAGTGTGCCCCACCCCCACCACCAGTGATGAGACTACTGCAGCAT
CCGTCCATCTGCTCAGACCCTACAGAAGAGCCAACTGCCCTAACTGCAGGACAGTCCACATCAGAAACAC
AGGAAGGAGGAAAGAAGGCAGCTCTGGGCGCAGTGCCCATCAGTGGGAAAGCTGGGAGGCCAGTGATGCC
TCCACCTCAAGTGCCTCTGCCCACATCTTCCATCTCGCCAGCCAAAATGGCCAATGGCACAGCAGGTACT
AAAGTGGCTCTGAGAAAAACCAAACAGGCCGCTGAGAAAATCTCAGCAGACAAAATCAGCAAAGAGGCCC
TGCTGGAATGTGCTGACCTACTGTCCAGTGCACTCACGGAACCTGTGCCCAACAGCCAGCTGGTAGACAC
TGGACACCAGCTGCTTGACTACTGCTCAGGCTATGTGGACTGCATCCCTCAAACTCGCAACAAATTTGCC
TTCCGAGAGGCTGTGAGCAAACTGGAACTCAGCCTGCAGGAGCTACAGGTTTCTTCAGCAGCTGCTGGTG
TGCCCGGGACAAACCCTGTCCTTAATAACTTATTGTCATGTGTACAGGAAATCAGTGATGTGGTGCAGAG
G


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222989 representing NM_001100108
Red=Cloning site Green=Tags(s)

MVLGTVLLPPNSYGRDQDTSLCCLCTEASESALPDLTDHFASCVEDGFEGDKTGGSSPEALHRPYGCDVE
PQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQG
WVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTT
ADGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLG
GGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMP
YGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMT
GDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRME
QPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPIL
PSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFT
RDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPP
KCYGGSFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTS
SMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPR
GATALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLGMAGVPEDGEQPGWPSPAKAAPVLPT
THNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQH
PSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGT
KVALRKTKQAAEKISADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFA
FREAVSKLELSLQELQVSSAAAGVPGTNPVLNNLLSCVQEISDVVQR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001100108
ORF Size 3501 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001100108.1, NP_001093578
RefSeq Size 11927
RefSeq ORF 3503
Locus ID 27
Cytogenetics 1q25.2
Protein Families Protein Kinase, Druggable Genome
Protein Pathways ErbB signaling pathway, Viral myocarditis
MW 126.5 kDa
Gene Summary This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq, Nov 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)