DPPA5 (NM_001025290) Human Tagged ORF Clone

CAT#: RC222509

DPPA5 (Myc-DDK-tagged)-Human developmental pluripotency associated 5 (DPPA5)

Need custom modification / cloning service?
Get a free quote

USD 505.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name DPPA5 (NM_001025290) Human Tagged ORF Clone
Symbol DPPA5
Synonyms ESG1; ESG1
Vector pCMV6-Entry
Sequence Data
>RC222509 representing NM_001025290
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAACTCTCCCGGCACGTAGACATATCCCGCCGTGGGTGAAAGTTCCCGAAGACCTGAAAGATCCAG
AGGTGTTCCAGGTCCAGACGCGGCTGCTGAAAGCCATTTTCGGCCCGGACGGATCTCGAATCCCTTACAT
CGAGCAGGTGAGCAAGGCCATGCTCGAGCTGAAGGCTCTGGAGTCTTCAGACCTCACCGAGGTCGTGGTT
TACGGCTCCTATTTGTACAAGCTCCGGACCAAGTGGATGCTCCAGTCCATGGCTGAGTGGCACCGCCAGC
GCCAGGAGCGAGGGATGCTCAAACTTGCCGAAGCCATGAATGCCCTCGAACTAGGCCCTTGGATGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222509 representing NM_001025290
Red=Cloning site Green=Tags(s)

MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVV
YGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001025290
ORF Size 348 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001025290.1, NM_001025290.2, NP_001020461
RefSeq Size 612
RefSeq ORF 351
Locus ID 340168
Cytogenetics 6q13
MW 13.3 kDa
Gene Summary This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and the long arm of chromosomes 14 and 19. [provided by RefSeq, Dec 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)