SKA1 (NM_001039535) Human Tagged ORF Clone

CAT#: RC221913

SKA1 (Myc-DDK-tagged)-Human spindle and kinetochore associated complex subunit 1 (SKA1), transcript variant 1

Product Images

Circular map for RC221913

• 

  Western blot validation of overexpression lysate (Cat# LY422066) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC221913 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified SKA1 protein (Cat# TP321913). The protein was produced from HEK293T cells transfected with SKA1 cDNA clone (Cat# RC221913) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: SKA1
• Synonyms: C18orf24
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC221913 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCTCGTCAGATCTGGAACAATTATGCTCTCATGTTAATGAAAAGATTGGCAATATTAAGAAAACCT
  TATCATTAAGAAACTGTGGCCAGGAACCTACCTTGAAAACTGTATTAAATAAAATAGGAGATGAGATCAT
  TGTAATAAATGAACTTCTAAATAAATTGGAATTGGAAATTCAGTATCAAGAACAAACCAACAATTCACTC
  AAGGAACTCTGTGAATCTCTTGAAGAAGATTACAAAGACATAGAACATCTTAAAGAAAACGTTCCTTCCC
  ATTTGCCTCAAGTAACAGTAACCCAGAGCTGTGTTAAGGGATCAGATCTTGATCCTGAAGAACCAATCAA
  AGTTGAAGAACCTGAACCCGTAAAGAAGCCTCCCAAAGAGCAAAGAAGTATTAAGGAAATGCCATTTATA
  ACTTGTGATGAGTTCAATGGTGTTCCTTCGTACATGAAATCCCGCTTAACCTATAATCAAATTAATGATG
  TTATTAAAGAAATCAACAAGGCAGTAATTAGTAAATATAAAATCCTACATCAGCCAAAAAAGTCTATGAA
  TTCTGTGACCAGAAATCTCTATCACAGATTTATTGATGAAGAAACGAAGGATACCAAAGGTCGTTATTTT
  ATAGTGGAAGCTGACATAAAGGAGTTCACAACTTTGAAAGCTGACAAGAAGTTTCACGTGTTACTGAATA
  TTTTACGACACTGCCGGAGGCTATCAGAGGTCCGAGGGGGAGGACTTACTCGTTATGTTATAACC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC221913 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSL
  KELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFI
  TCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYF
  IVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001039535
• ORF Size: 765 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001039535.3
• RefSeq Size: 2938 bp
• RefSeq ORF: 768 bp
• Locus ID: 220134
• UniProt ID: Q96BD8
• Cytogenetics: 18q21.1
• MW: 29.5 kDa
• Gene Summary: Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation (PubMed:17093495, PubMed:19289083, PubMed:23085020). Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint (PubMed:17093495). The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies (PubMed:19289083). The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner (PubMed:19289083). Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules (PubMed:23085020). In the complex, it mediates the interaction with microtubules (PubMed:19289083, PubMed:23085020).[UniProtKB/Swiss-Prot Function]