OSCAR (NM_133168) Human Tagged ORF Clone

CAT#: RC221788

OSCAR (Myc-DDK-tagged)-Human osteoclast associated, immunoglobulin-like receptor (OSCAR), transcript variant 5

Product Images

Circular map for RC221788

• 

  Western blot validation of overexpression lysate (Cat# LY408890) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC221788 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: OSCAR
• Synonyms: PIgR-3; PIGR3
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC221788 representing NM_133168
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCCTGGTGCTGATCCTCCAGCTGCTGACCCTCTTCCCCCCAGCTTCATACCACCCTAAGCCATGGC
  TGGGAGCTCAGCCGGCTACAGTTGTGACCCCTGGGGTCAACGTGACCTTGAGATGCCGGGCACCCCAACC
  CGCTTGGAGATTTGGACTTTTCAAGCCTGGAGAGATCGCTCCCCTTCTCTTCCGGGATGTGTCCTCCGAG
  CTGGCAGAATTCTTTCTGGAGGAGGTGACTCCAGCCCAAGGGGGAATTTACCGCTGCTGCTACCGAAGGC
  CAGACTGGGGGCCGGGTGTCTGGTCCCAGCCCAGCGATGTCCTGGAGCTGCTGGTGACAGAGGAGCTGCC
  GCGGCCGTCGCTGGTGGCGCTGCCCGGGCCGGTGGTGGGTCCTGGCGCCAACGTGAGCCTGCGCTGCGCG
  GGCCGCCTGCGGAACATGAGCTTCGTGCTGTACCGCGAGGGCGTGGCGGCCCCGCTGCAGTACCGCCACT
  CCGCGCAGCCCTGGGCCGACTTCACGCTGCTGGGCGCCCGCGCCCCCGGCACCTACAGCTGCTACTATCA
  CACGCCCTCCGCGCCCTACGTGCTGTCGCAGCGCAGCGAGGTGCTGGTCATCAGCTGGGAAGACTCTGGC
  TCCTCCGACTACACCCGGGGGAACCTAGTCCGCCTGGGGCTGGCCGGGCTGGTCCTCATCTCCCTGGGCG
  CGCTGGTCACTTTTGACTGGCGCAGTCAGAACCGCGCTCCTGCTGGTATCCGCCCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC221788 representing NM_133168
  Red=Cloning site Green=Tags(s)
  
  MALVLILQLLTLFPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSE
  LAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCA
  GRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEDSG
  SSDYTRGNLVRLGLAGLVLISLGALVTFDWRSQNRAPAGIRP
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_133168
• ORF Size: 756 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_133168.3
• RefSeq Size: 1395 bp
• RefSeq ORF: 759 bp
• Locus ID: 126014
• UniProt ID: Q8IYS5
• Cytogenetics: 19q13.42
• Domains: IG
• Protein Families: Druggable Genome
• MW: 27.4 kDa
• Gene Summary: Osteoclasts are multinucleated cells that resorb bone and are essential for bone homeostasis. This gene encodes an osteoclast-associated receptor (OSCAR), which is a member of the leukocyte receptor complex protein family that plays critical roles in the regulation of both innate and adaptive immune responses. The encoded protein may play a role in oxidative stress-mediated atherogenesis as well as monocyte adhesion. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]