VAMP1 (NM_014231) Human Tagged ORF Clone
CAT#: RC220854
VAMP1 (Myc-DDK-tagged)-Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_014231" in other vectors (6)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | VAMP1 |
Synonyms | CMS25; SPAX1; SYB1; VAMP-1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC220854 representing NM_014231
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCTGCTCCAGCTCAGCCACCTGCTGAAGGGACAGAAGGGACTGCCCCAGGTGGGGGTCCCCCTGGCC CTCCTCCTAACATGACCAGTAACAGACGACTACAGCAAACCCAGGCACAAGTGGAGGAGGTGGTGGACAT CATACGTGTGAACGTGGACAAGGTCCTGGAGAGGGACCAGAAGCTGTCAGAGCTGGATGACCGAGCTGAT GCCTTGCAGGCAGGAGCATCACAATTTGAGAGCAGTGCTGCAAAGCTAAAGAGGAAGTATTGGTGGAAAA ACTGCAAGATGATGATCATGCTGGGAGCCATCTGTGCCATCATCGTGGTAGTTATTGTAATCTACTTTTT TACT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC220854 representing NM_014231
Red=Cloning site Green=Tags(s) MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRAD ALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_014231 |
ORF Size | 354 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_014231.5 |
RefSeq Size | 2748 bp |
RefSeq ORF | 357 bp |
Locus ID | 6843 |
UniProt ID | P23763 |
Cytogenetics | 12p13.31 |
Domains | synaptobrevin |
Protein Families | Secreted Protein, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
MW | 12.7 kDa |
Gene Summary | Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2014] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC220854L1 | Lenti ORF clone of Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1, Myc-DDK-tagged |
USD 450.00 |
|
RC220854L2 | Lenti ORF clone of Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1, mGFP tagged |
USD 450.00 |
|
RC220854L3 | Lenti ORF clone of Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1, Myc-DDK-tagged |
USD 450.00 |
|
RC220854L4 | Lenti ORF clone of Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1, mGFP tagged |
USD 450.00 |
|
RG220854 | VAMP1 (tGFP-tagged) - Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1 |
USD 350.00 |
|
SC311201 | VAMP1 (untagged)-Human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1 |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review