alpha Glucosidase II(GANAB) (NM_198335) Human Tagged ORF Clone

CAT#: RC219222

GANAB (Myc-DDK-tagged)-Human glucosidase, alpha, neutral AB (GANAB), transcript variant 3

Change vector?

  • TrueORF®

USD 1,473


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name alpha Glucosidase II(GANAB) (NM_198335) Human Tagged ORF Clone
Symbol GANAB
Synonyms G2AN; GIIA; GLUII; PKD3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC219222 representing NM_198335
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGTAGCGGCAGTGGCGGCGCGTAGGAGGCGGTCTTGGGCGTCTTTGGTACTGGCTTTTTTAG
GGGTCTGCCTGGGGATTACCCTTGCTGTGGATAGAAGCAACTTTAAGACCTGTGAAGAGAGTTCTTTCTG
CAAGCGACAGAGAAGCATACGGCCAGGCCTCTCTCCATACCGAGCCTTGCTGGACTCTCTACAGCTTGGT
CCTGATTCCCTCACGGTCCATCTGATCCATGAGGTCACCAAGGTGTTGCTGGTGCTAGAGCTTCAGGGGC
TTCAAAAGAACATGACTCGGTTCAGGATTGATGAGCTGGAGCCTCGGCGACCCCGATACCGTGTACCAGA
TGTTTTGGTGGCTGATCCACCAATAGCCCGGCTTTCTGTCTCTGGTCGTGATGAGAACAGTGTGGAGTTA
ACCATGGCTGAGGGACCCTACAAGATCATCTTGACAGCACGGCCATTCCGCCTTGACCTACTAGAGGACC
GAAGTCTTTTGCTTAGTGTCAATGCCCGAGGACTCTTGGAGTTTGAGCATCAGAGGGCCCCTAGGGTCTC
TTTCTCGGATAAGGTTAATCTCACGCTTGGTAGCATATGGGATAAGATCAAGAACCTTTTCTCTAGGCAA
GGATCAAAAGACCCAGCTGAGGGCGATGGGGCCCAGCCTGAGGAAACACCCAGGGATGGCGACAAGCCAG
AGGAGACTCAGGGGAAGGCAGAGAAAGATGAGCCAGGAGCCTGGGAGGAGACATTCAAAACTCACTCTGA
CAGCAAGCCGTATGGCCCCATGTCTGTGGGTTTGGACTTCTCTCTGCCAGGCATGGAGCATGTCTATGGG
ATCCCTGAGCATGCAGACAACCTGAGGCTGAAGGTCACTGAGGGTGGGGAGCCATATCGCCTCTACAATT
TGGATGTGTTCCAGTATGAGCTGTACAACCCAATGGCCTTGTATGGGTCTGTGCCTGTGCTCCTGGCACA
CAACCCTCATCGCGACTTGGGCATCTTCTGGCTCAATGCTGCAGAGACCTGGGTTGATATATCTTCCAAC
ACTGCCGGGAAGACCCTGTTTGGGAAGATGATGGACTACCTGCAGGGCTCTGGGGAGACCCCACAGACAG
ATGTTCGCTGGATGTCAGAGACTGGCATCATTGACGTCTTCCTGCTGCTGGGGCCCTCCATCTCTGATGT
TTTCCGGCAATATGCTAGTCTCACAGGAACCCAGGCGTTGCCCCCACTCTTCTCCCTCGGCTACCACCAG
AGCCGTTGGAACTACCGGGACGAGGCTGATGTGCTGGAAGTGGATCAGGGCTTTGATGATCACAACCTGC
CCTGTGATGTCATCTGGCTAGACATTGAACATGCTGATGGCAAGCGGTATTTCACCTGGGACCCCAGTCG
CTTCCCTCAGCCCCGCACCATGCTTGAGCGCTTGGCTTCTAAGAGGCGGAAGCTGGTGGCCATCGTAGAC
CCCCACATCAAGGTGGACTCCGGCTACCGAGTTCACGAGGAGCTGCGGAACCTGGGGCTGTATGTTAAAA
CCCGGGATGGCTCTGACTATGAGGGCTGGTGCTGGCCAGGCTCAGCTGGTTACCCTGACTTCACTAATCC
CACGATGAGGGCCTGGTGGGCTAACATGTTCAGCTATGACAATTATGAGGGCTCAGCTCCCAACCTCTTT
GTCTGGAATGACATGAACGAACCATCTGTGTTCAATGGTCCTGAGGTCACCATGCTCAAGGATGCCCAGC
ATTATGGGGGCTGGGAGCACCGGGATGTGCATAACATCTATGGCCTTTATGTGCACATGGCGACTGCTGA
TGGGCTGAGACAGCGCTCTGGGGGCATGGAACGCCCCTTTGTCCTGGCCAGGGCCTTCTTCGCTGGCTCC
CAGCGCTTTGGAGCCGTGTGGACAGGGGACAACACTGCCGAGTGGGACCATTTGAAGATCTCTATTCCTA
TGTGTCTCAGCTTGGGGCTGGTGGGACTTTCCTTCTGTGGGGCGGATGTGGGTGGCTTCTTCAAAAACCC
AGAGCCAGAGCTGCTTGTGCGCTGGTACCAGATGGGTGCTTACCAGCCATTCTTCCGGGCACATGCCCAC
TTGGACACTGGGCGACGAGAGCCATGGCTGTTACCATCTCAGCACAATGATATAATCCGAGATGCCTTGG
GCCAGCGATATTCTTTGCTGCCCTTCTGGTACACCCTCTTATATCAGGCCCATCGGGAAGGCATTCCTGT
CATGAGGCCCCTGTGGGTGCAGTACCCTCAGGATGTGACTACCTTCAATATAGATGATCAGTACTTGCTT
GGGGATGCGTTGCTGGTTCACCCTGTATCAGACTCTGGAGCCCATGGTGTCCAGGTCTATCTGCCTGGCC
AAGGGGAGGTGTGGTATGACATTCAAAGCTACCAGAAGCATCATGGTCCCCAGACCCTGTACCTGCCTGT
AACTCTAAGCAGTATCCCTGTGTTCCAGCGTGGAGGGACAATCGTGCCTCGATGGATGCGAGTGCGGCGG
TCTTCAGAATGTATGAAGGATGACCCCATCACTCTCTTTGTTGCACTTAGCCCTCAGGGTACAGCTCAAG
GAGAGCTCTTTCTGGATGATGGGCACACGTTCAACTATCAGACTCGCCAAGAGTTCCTGCTGCGTCGATT
CTCATTCTCTGGCAACACCCTTGTCTCCAGCTCAGCAGACCCTGAAGGACACTTTGAGACACCAATCTGG
ATTGAGCGGGTGGTGATAATAGGGGCTGGAAAGCCAGCAGCTGTGGTACTCCAGACAAAAGGATCTCCAG
AAAGCCGCCTGTCCTTCCAGCATGACCCTGAGACCTCTGTGTTGGTCCTGCGCAAGCCTGGCATCAATGT
GGCATCTGATTGGAGTATTCACCTGCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219222 representing NM_198335
Red=Cloning site Green=Tags(s)

MAAVAAVAARRRRSWASLVLAFLGVCLGITLAVDRSNFKTCEESSFCKRQRSIRPGLSPYRALLDSLQLG
PDSLTVHLIHEVTKVLLVLELQGLQKNMTRFRIDELEPRRPRYRVPDVLVADPPIARLSVSGRDENSVEL
TMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSFSDKVNLTLGSIWDKIKNLFSRQ
GSKDPAEGDGAQPEETPRDGDKPEETQGKAEKDEPGAWEETFKTHSDSKPYGPMSVGLDFSLPGMEHVYG
IPEHADNLRLKVTEGGEPYRLYNLDVFQYELYNPMALYGSVPVLLAHNPHRDLGIFWLNAAETWVDISSN
TAGKTLFGKMMDYLQGSGETPQTDVRWMSETGIIDVFLLLGPSISDVFRQYASLTGTQALPPLFSLGYHQ
SRWNYRDEADVLEVDQGFDDHNLPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASKRRKLVAIVD
PHIKVDSGYRVHEELRNLGLYVKTRDGSDYEGWCWPGSAGYPDFTNPTMRAWWANMFSYDNYEGSAPNLF
VWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGLYVHMATADGLRQRSGGMERPFVLARAFFAGS
QRFGAVWTGDNTAEWDHLKISIPMCLSLGLVGLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAH
LDTGRREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDVTTFNIDDQYLL
GDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRR
SSECMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIW
IERVVIIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHLR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_198335
ORF Size 2898 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_198335.1, NM_198335.2, NM_198335.3, NP_938149
RefSeq Size 3921
RefSeq ORF 2901
Locus ID 23193
Cytogenetics 11q12.3
Protein Families Transmembrane, Druggable Genome
Protein Pathways N-Glycan biosynthesis, Metabolic pathways
MW 109.3 kDa
Gene Summary This gene encodes the alpha subunit of glucosidase II and a member of the glycosyl hydrolase 31 family of proteins. The heterodimeric enzyme glucosidase II plays a role in protein folding and quality control by cleaving glucose residues from immature glycoproteins in the endoplasmic reticulum. Expression of the encoded protein is elevated in lung tumor tissue and in response to UV irradiation. Mutations in this gene cause autosomal-dominant polycystic kidney and liver disease. [provided by RefSeq, Jul 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations