RBP2 (NM_004164) Human Tagged ORF Clone

CAT#: RC217970

Reviews ()
Write a review

RBP2 (Myc-DDK-tagged)-Human retinol binding protein 2, cellular (RBP2)



  "NM_004164" in other vectors (6)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 118.00

USD 462.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RBP2
Synonyms CRABP-II; CRBP2; CRBPII; RBPC2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC217970 representing NM_004164
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAAGGGACCAGAATGGAACCTGGGAGATGGAGAGTAATGAAAACTTTGAGGGCTACATGAAGGCCC
TGGATATTGATTTTGCCACCCGCAAGATTGCAGTACGTCTCACTCAGACGAAGGTTATTGATCAAGATGG
TGATAACTTCAAGACAAAAACCACTAGCACATTCCGCAACTATGATGTGGATTTCACTGTTGGAGTAGAG
TTTGACGAGTACACAAAGAGCCTGGATAACCGGCATGTTAAGGCACTGGTCACCTGGGAAGGTGATGTCC
TTGTGTGTGTGCAAAAGGGGGAGAAGGAGAACCGCGGCTGGAAGCAGTGGATTGAGGGGGACAAGCTGTA
CCTGGAGCTGACCTGTGGTGACCAGGTGTGCCGTCAAGTGTTCAAAAAGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217970 representing NM_004164
Red=Cloning site Green=Tags(s)

MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVE
FDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004164
ORF Size 402 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004164.3
RefSeq Size 700 bp
RefSeq ORF 405 bp
Locus ID 5948
UniProt ID P50120
Cytogenetics 3q23
MW 15.5 kDa
Gene Summary This gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle. [provided by RefSeq, Aug 2015]

Other Versions

Other products for "RBP2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


RBP2 Antibody - middle region
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.