XAGE1D (NM_020411) Human Tagged ORF Clone
CAT#: RC217671
- TrueORF®
XAGE1D (Myc-DDK-tagged)-Human X antigen family, member 1D (XAGE1D), transcript variant a
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
"NM_020411" in other vectors (4)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | XAGE1D |
Synonyms | CT12.1; CT12.1D; CTP9 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC217671 representing NM_020411
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGAGCCCCAAAAAGAAGAACCAGCAGCTGAAAGTCGGGATCCTACACCTGGGCAGCAGACAGAAGA AGATCAGGATACAGCTGAGATCCCAGTGCGCGACATGGAAGGTGATCTGCAAGAGCTGCATCAGTCAAAC ACCGGGGATAAATCTGGATTTGGGTTCCGGCGTCAAGGTGAAGATAATACCTAAAGAGGAACACTGTAAA ATGCCAGAAGCAGGTGAAGAGCAACCACAAGTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC217671 representing NM_020411
Red=Cloning site Green=Tags(s) MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCK MPEAGEEQPQV myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_020411 |
ORF Size | 243 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_020411.2, NP_065144.2 |
RefSeq Size | 634 bp |
RefSeq ORF | 245 bp |
Locus ID | 9503 |
Cytogenetics | Xp11.22 |
MW | 9.1 kDa |
Gene Summary | This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in Ewing's sarcoma, alveolar rhabdomyosarcoma and normal testis. The protein encoded by this gene contains a nuclear localization signal and shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. Alternative splicing of this gene, in addition to alternative transcription start sites, results in multiple transcript variants. [provided by RefSeq, Jan 2010] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC217671L3 | Lenti-ORF clone of XAGE1D (Myc-DDK-tagged)-Human X antigen family, member 1D (XAGE1D), transcript variant a |
USD 525.00 |
|
RC217671L4 | Lenti-ORF clone of XAGE1D (mGFP-tagged)-Human X antigen family, member 1D (XAGE1D), transcript variant a |
USD 525.00 |
|
RG217671 | XAGE1D (tGFP-tagged) - Human X antigen family, member 1D (XAGE1D), transcript variant a |
USD 425.00 |
|
SC304761 | XAGE1D (untagged)-Human X antigen family, member 1D (XAGE1D), transcript variant a |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review