CREM (NM_182772) Human Tagged ORF Clone

CAT#: RC216406

CREM (Myc-DDK-tagged)-Human cAMP responsive element modulator (CREM), transcript variant 16

Product Images

Circular map for RC216406

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CREM
• Synonyms: CREM-2; hCREM-2; ICER
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC216406 representing NM_182772
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTGGTGGCATCAGCATAATCTATGTTTCAGGCGTCCTATAGAAGAGGATTATTCTTCAGGGGATGTGG
  AAGAAAAGGTAGCAGCAATTGCAGAGACAGATGAATCTGCAGAATCAGAAGGTGTAATTGATTCTCATAA
  ACGTAGAGAAATCCTTTCACGAAGACCCTCTTATAGGAAAATACTGAATGAACTGTCCTCTGATGTGCCT
  GGTGTTCCCAAGATTGAAGAAGAGAGATCAGAGGAAGAAGGAACACCACCTAGTATTGCTACCATGGCAG
  TACCAACTAGCATATATCAGACTAGCACGGGGCAATACACTGCCACTGGTGACATGCCAACTTACCAGAT
  CCGAGCTCCTACTGCTGCTTTGCCACAGGGAGTGGTGATGGCTGCATCGCCCGGAAGTTTGCACAGTCCC
  CAGCAGCTGGCAGAAGAAGCAACACGCAAACGAGAGCTGAGGCTAATGAAAAACAGGGAAGCTGCCAAAG
  AATGTCGACGTCGAAAGAAAGAATATGTAAAATGTCTGGAGAGCCGAGTTGCAGTGCTGGAAGTCCAGAA
  CAAGAAGCTTATAGAGGAACTTGAAACCTTGAAAGACATTTGTTCTCCCAAAACAGATTAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC216406 representing NM_182772
  Red=Cloning site Green=Tags(s)
  
  MWWHQHNLCFRRPIEEDYSSGDVEEKVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVP
  GVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYTATGDMPTYQIRAPTAALPQGVVMAASPGSLHSP
  QQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_182772
• ORF Size: 621 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_182772.2
• RefSeq Size: 1971 bp
• RefSeq ORF: 624 bp
• Locus ID: 1390
• UniProt ID: Q03060
• Cytogenetics: 10p11.21
• Protein Families: Druggable Genome, Transcription Factors
• MW: 23.3 kDa
• Gene Summary: This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq, Jul 2008]