CCBL1(KYAT1) (NM_004059) Human Tagged ORF Clone

CAT#: RC216317

CCBL1 (Myc-DDK-tagged)-Human cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 1

Change vector?

USD 536


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CCBL1(KYAT1) (NM_004059) Human Tagged ORF Clone
Symbol KYAT1
Synonyms CCBL1; GTK; KAT1; KATI
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC216317 representing NM_004059
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAACAGCTGCAGGCCCGAAGGCTAGACGGGATCGACTACAACCCCTGGGTGGAGTTTGTGAAAC
TGGCCAGTGAGCATGACGTCGTGAACTTGGGCCAGGGCTTCCCGGATTTCCCACCACCAGACTTTGCCGT
GGAAGCCTTTCAGCACGCTGTCAGTGGAGACTTCATGCTTAACCAGTACACCAAGACATTTGGTTACCCA
CCACTGACGAAGATCCTGGCAAGTTTCTTTGGGGAGCTGCTGGGTCAGGAGATAGACCCGCTCAGGAATG
TGCTGGTGACTGTTGGTGGCTATGGGGCCCTGTTCACAGCCTTCCAGGCCCTGGTGGACGAAGGAGACGA
GGTCATCATCATCGAACCCTTTTTTGACTGCTACGAGCCCATGACAATGATGGCAGGGGGTCGTCCTGTG
TTTGTGTCCCTGAAGCCGGGTCCCATCCAGAATGGAGAACTGGGTTCCAGCAGCAACTGGCAGCTGGACC
CCATGGAGCTGGCCGGCAAATTCACATCACGCACCAAAGCCCTGGTCCTCAACACCCCCAACAACCCCCT
GGGCAAGGTGTTCTCCAGGGAAGAGCTGGAGCTGGTGGCCAGCCTTTGCCAGCAGCATGACGTGGTGTGT
ATCACTGATGAAGTCTACCAGTGGATGGTCTACGACGGGCACCAGCACATCAGCATTGCCAGCCTCCCTG
GCATGTGGGAACGGACCCTGACCATCGGCAGCGCCGGCAAGACCTTCAGCGCCACTGGCTGGAAGGTGGG
CTGGGTCCTGGGTCCAGATCACATCATGAAGCACCTGCGGACCGTGCACCAGAACTCCGTCTTCCACTGC
CCCACGCAGAGCCAGGCTGCAGTAGCCGAGAGCTTTGAACGGGAGCAGCTGCTCTTCCGCCAACCCAGCA
GCTACTTTGTGCAGTTCCCGCAGGCCATGCAGCGCTGCCGTGACCACATGATACGTAGCCTACAGTCAGT
GGGCCTGAAGCCCATCATCCCTCAGGGCAGCTACTTCCTCATCACAGACATCTCAGACTTCAAGAGGAAG
ATGCCTGACTTGCCTGGAGCTGTGGATGAGCCCTATGACAGACGCTTCGTCAAGTGGATGATCAAGAACA
AGGGCTTGGTGGCCATCCCTGTCTCCATCTTCTATAGTGTGCCACATCAGAAGCACTTTGACCACTATAT
CCGCTTCTGTTTTGTGAAGGATGAAGCCACGCTCCAGGCCATGGACGAGAAGCTGCGGAAGTGGAAGGTG
GAACTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC216317 representing NM_004059
Red=Cloning site Green=Tags(s)

MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYP
PLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPV
FVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVC
ITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHC
PTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRK
MPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV
EL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004059
ORF Size 1266 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004059.1, NM_004059.2, NM_004059.4, NP_004050
RefSeq Size 1925
RefSeq ORF 1269
Locus ID 883
Cytogenetics 9q34.11
Domains aminotran_1_2
MW 47.7 kDa
Gene Summary This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.