EEA1 (NM_003566) Human Tagged ORF Clone

CAT#: RC215396

EEA1 (Myc-DDK-tagged)-Human early endosome antigen 1 (EEA1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EEA1 (NM_003566) Human Tagged ORF Clone
Symbol EEA1
Synonyms MST105; MSTP105; ZFYVE2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC215396 representing NM_003566
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTAAGGAGGATTTTACAGAGGACTCCTGGGAGAGTTGGCTCTCAAGGTTCTGATTTAGATTCATCAG
CAACTCCTATAAACACAGTGGACGTCAATAATGAAAGCTCTTCAGAGGGTTTCATATGTCCCCAGTGTAT
GAAATCTCTTGGATCTGCTGATGAACTTTTCAAACATTATGAAGCTGTTCATGATGCTGGTAATGACTCA
GGTCATGGAGGAGAGTCTAATCTTGCTTTGAAGCGAGATGATGTAACACTGCTCAGACAAGAGGTCCAAG
ACCTACAGGCTTCACTTAAGGAAGAAAAATGGTACTCGGAAGAATTAAAGAAGGAATTAGAAAAATATCA
AGGGCTGCAGCAGCAAGAGGCCAAACCTGATGGGTTGGTGACTGATTCATCAGCAGAACTACAGTCTTTG
GAACAGCAATTAGAAGAAGCCCAAACAGAAAATTTTAATATTAAGCAAATGAAAGACTTATTTGAACAGA
AAGCAGCCCAACTTGCTACTGAAATTGCAGATATAAAGTCAAAGTATGATGAAGAAAGGAGTCTTCGAGA
AGCTGCTGAACAAAAAGTGACACGTCTGACAGAAGAATTAAACAAAGAGGCAACTGTAATTCAAGATCTG
AAGACGGAACTGCTTCAGAGACCTGGTATAGAAGATGTTGCCGTGCTAAAGAAAGAACTGGTCCAAGTTC
AAACACTAATGGATAACATGACCTTGGAACGTGAGCGAGAATCTGAAAAACTCAAAGATGAATGCAAAAA
ATTGCAGTCACAATATGCTAGCTCAGAGGCCACAATAAGCCAGCTAAGGAGTGAACTTGCCAAAGGCCCC
CAGGAAGTTGCTGTATATGTACAGGAACTACAAAAACTGAAAAGTTCAGTTAATGAATTAACACAAAAAA
ATCAGACCTTGACAGAAAACTTGCTGAAAAAAGAACAAGACTATACTAAGTTAGAGGAGAAACATAATGA
AGAATCTGTGAGTAAAAAGAATATTCAGGCAACCCTTCATCAAAAAGACCTAGATTGTCAACAGCTTCAG
TCAAGATTGTCTGCATCTGAAACCTCACTGCATAGAATACATGTAGAACTAAGTGAAAAAGGAGAAGCTA
CTCAAAAGCTCAAAGAAGAATTATCTGAGGTAGAGACCAAGTACCAGCATCTAAAGGCGGAGTTTAAGCA
GCTACAACAACAGAGAGAAGAAAAGGAGCAGCATGGGTTACAACTCCAAAGTGAAATTAATCAATTACAT
AGCAAACTTCTGGAGACAGAGCGCCAACTAGGGGAAGCTCATGGTAGGCTGAAGGAACAGAGACAGCTTT
CAAGTGAAAAGTTGATGGATAAAGAACAACAAGTGGCTGATTTACAACTCAAACTTTCTCGGTTAGAAGA
GCAGTTGAAGGAAAAAGTTACAAATTCTACAGAATTGCAGCATCAATTAGATAAAACAAAGCAACAGCAT
CAAGAACAACAGGCTCTTCAGCAAAGCACCACGGCAAAACTTCGAGAAGCTCAGAATGATTTGGAACAAG
TTCTACGTCAAATTGGCGATAAGGACCAAAAGATCCAGAACCTTGAAGCTTTATTACAGAAGAGTAAAGA
AAATATTTCATTACTAGAAAAAGAAAGAGAAGATCTTTATGCAAAAATTCAGGCTGGTGAAGGAGAGACT
GCTGTTCTTAACCAGTTACAAGAAAAAAACCATACACTACAGGAGCAAGTAACTCAACTAACAGAGAAGC
TGAAGAATCAGTCAGAAAGTCATAAACAAGCCCAGGAGAATTTGCATGACCAGGTACAAGAGCAGAAGGC
ACATCTTAGAGCTGCACAAGACCGTGTCCTTTCCCTAGAAACTAGTGTCAATGAATTAAATAGTCAATTA
AATGAAAGCAAGGAGAAGGTCTCCCAGCTTGACATACAGATTAAAGCCAAAACCGAACTATTACTATCAG
CAGAAGCAGCAAAAACTGCTCAAAGAGCTGATCTTCAGAATCATTTGGACACAGCTCAAAATGCATTACA
AGATAAACAGCAGGAGTTAAATAAGATTACTACTCAGTTGGATCAGGTCACTGCAAAGTTACAAGACAAG
CAAGAACATTGCAGTCAGCTGGAAAGTCATCTTAAAGAATATAAAGAGAAATACCTCTCTTTAGAACAGA
AAACCGAAGAGCTAGAAGGTCAAATTAAGAAACTAGAAGCTGATAGTCTTGAAGTTAAAGCAAGCAAGGA
GCAGGCTTTGCAAGATCTACAACAGCAAAGACAGCTGAACACAGATTTAGAGCTCAGAGCCACAGAATTG
AGTAAACAACTTGAAATGGAGAAGGAAATAGTATCCAGTACAAGATTGGATCTACAGAAAAAATCTGAAG
CCCTTGAAAGTATCAAGCAAAAGCTTACCAAGCAAGAGGAAGAAAAACAAATCCTGAAACAAGATTTTGA
AACTTTAAGTCAAGAAACAAAGATTCAGCATGAGGAATTGAATAACAGAATTCAAACAACAGTAACAGAA
CTACAAAAAGTGAAAATGGAGAAAGAAGCTTTAATGACAGAGCTTTCTACAGTAAAGGACAAACTATCAA
AAGTTTCTGATTCTTTGAAAAACTCTAAAAGTGAATTTGAAAAGGAGAATCAGAAAGGAAAAGCCGCTAT
ATTAGACTTGGAAAAAACTTGCAAAGAATTAAAGCATCAACTTCAAGTGCAGATGGAAAACACACTTAAG
GAACAGAAGGAACTGAAAAAGTCACTTGAAAAAGAGAAGGAGGCTTCTCATCAGTTGAAATTGGAACTCA
ATTCAATGCAGGAACAACTTATACAGGCCCAGAATACTTTAAAACAAAATGAAAAAGAAGAGCAACAACT
TCAGGGGAACATAAATGAGCTAAAGCAATCAAGTGAACAGAAGAAAAAACAAATTGAAGCACTCCAAGGA
GAGCTTAAAATTGCTGTTTTACAGAAGACAGAGCTTGAGAATAAACTACAGCAGCAGTTAACACAGGCAG
CCCAGGAACTTGCAGCAGAGAAAGAGAAAATATCAGTATTACAAAACAACTATGAAAAAAGTCAGGAAAC
TTTCAAACAGCTTCAATCTGATTTCTATGGGAGGGAATCTGAACTTCTAGCCACCAGGCAAGATCTTAAG
TCTGTAGAAGAGAAGCTTTCTCTAGCACAGGAGGACTTGATTTCAAACAGAAATCAAATTGGAAATCAAA
ATAAATTGATTCAAGAACTGAAGACTGCCAAGGCTACATTGGAGCAGGATTCAGCAAAGAAAGAACAGCA
ATTGCAGGAGCGATGTAAAGCACTACAAGACATTCAGAAAGAAAAGTCACTGAAAGAAAAAGAACTGGTA
AATGAGAAGTCTAAATTGGCAGAGATAGAAGAAATTAAATGTAGACAAGAAAAAGAAATCACTAAACTAA
ACGAAGAACTCAAGTCCCACAAACTAGAAAGCATAAAGGAGATAACAAATCTTAAAGATGCTAAACAGCT
TCTAATTCAGCAGAAATTAGAACTTCAAGGAAAAGCGGACTCCCTGAAGGCAGCTGTTGAACAGGAGAAG
AGAAATCAGCAGATACTAAAAGACCAGGTGAAAAAGGAAGAAGAGGAGCTGAAGAAAGAATTTATTGAGA
AAGAAGCTAAGTTGCATTCCGAAATAAAAGAAAAGGAAGTAGGAATGAAGAAGCATGAAGAAAATGAGGC
TAAACTTACCATGCAGATTACAGCATTAAATGAAAACTTAGGCACTGTGAAGAAGGAGTGGCAATCTAGT
CAACGGAGAGTTAGTGAGCTTGAGAAACAAACGGATGACTTACGGGGTGAAATTGCAGTATTAGAAGCAA
CGGTTCAGAATAATCAAGATGAAAGGAGAGCACTACTGGAAAGATGTCTTAAAGGAGAAGGTGAAATAGA
AAAGCTTCAAACCAAAGTATTAGAATTGCAAAGAAAGCTGGATAATACAACTGCAGCAGTGCAGGAGCTG
GGCAGAGAAAACCAATCACTTCAGATCAAACATACACAAGCGTTGAATAGAAAGTGGGCCGAAGACAATG
AAGTACAAAACTGTATGGCCTGTGGGAAAGGCTTTTCAGTAACAGTGAGACGGCATCACTGCCGACAGTG
TGGAAATATCTTCTGTGCTGAATGTTCAGCCAAAAATGCCTTAACTCCTTCCTCCAAGAAGCCTGTTCGT
GTCTGTGATGCATGTTTCAATGACTTGCAAGGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215396 representing NM_003566
Red=Cloning site Green=Tags(s)

MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDS
GHGGESNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQQQEAKPDGLVTDSSAELQSL
EQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDEERSLREAAEQKVTRLTEELNKEATVIQDL
KTELLQRPGIEDVAVLKKELVQVQTLMDNMTLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGP
QEVAVYVQELQKLKSSVNELTQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQ
SRLSASETSLHRIHVELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLH
SKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQH
QEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEGET
AVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKAHLRAAQDRVLSLETSVNELNSQL
NESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDK
QEHCSQLESHLKEYKEKYLSLEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATEL
SKQLEMEKEIVSSTRLDLQKKSEALESIKQKLTKQEEEKQILKQDFETLSQETKIQHEELNNRIQTTVTE
LQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQLQVQMENTLK
EQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQNEKEEQQLQGNINELKQSSEQKKKQIEALQG
ELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNNYEKSQETFKQLQSDFYGRESELLATRQDLK
SVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELV
NEKSKLAEIEEIKCRQEKEITKLNEELKSHKLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEK
RNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSS
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQEL
GRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVR
VCDACFNDLQG

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003566
ORF Size 4233 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003566.2, NM_003566.3, NP_003557
RefSeq Size 4874
RefSeq ORF 4236
Locus ID 8411
Cytogenetics 12q22
Domains FYVE, M, zf-C2H2
Protein Pathways Endocytosis
MW 162.3 kDa
Gene Summary Binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in endosomal trafficking. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)