Protein Kinase D2 (PRKD2) (NM_016457) Human Tagged ORF Clone

CAT#: RC215335

Reviews ()
Write a review

PRKD2 (Myc-DDK-tagged)-Human protein kinase D2 (PRKD2), transcript variant 1



Reconstitution Protocol

USD 804.00

In Stock*

Size
    • 10 ug

Product images

Other products for "PRKD2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PRKD2
Synonyms HSPC187; nPKC-D2; PKD2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215335 representing NM_016457
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACCGCCCCCTCTTATCCCGCCGGGCTCCCTGGCTCTCCCGGGCCGGGGTCTCCTCCGCCCCCCG
GCGGCCTAGAGCTGCAGTCGCCGCCACCGCTACTGCCCCAGATCCCGGCCCCGGGTTCCGGGGTCTCCTT
TCACATCCAGATCGGGCTGACCCGCGAGTTCGTGCTGTTGCCCGCCGCCTCCGAGCTGGCTCATGTGAAG
CAGCTGGCCTGTTCCATCGTGGACCAGAAGTTCCCTGAGTGTGGCTTCTACGGCCTTTACGACAAGATCC
TGCTTTTCAAACATGACCCCACGTCGGCCAACCTCCTGCAGCTGGTGCGCTCGTCCGGAGACATCCAGGA
GGGCGACCTGGTGGAGGTGGTGCTGTCGGCCTCGGCCACCTTCGAGGACTTCCAGATCCGCCCGCACGCC
CTCACGGTGCACTCCTATCGGGCGCCTGCCTTCTGTGATCACTGCGGGGAGATGCTCTTCGGCCTAGTGC
GCCAGGGCCTCAAGTGCGATGGCTGCGGGCTGAACTACCACAAGCGCTGTGCCTTCAGCATCCCCAACAA
CTGTAGTGGGGCCCGCAAACGGCGCCTGTCATCCACGTCTCTGGCCAGTGGCCACTCGGTGCGCCTCGGC
ACCTCCGAGTCCCTGCCCTGCACGGCTGAAGAGCTGAGCCGTAGCACCACCGAACTCCTGCCTCGCCGTC
CCCCGTCATCCTCTTCCTCCTCTTCTGCCTCATCGTATACGGGCCGCCCCATTGAGCTGGACAAGATGCT
GCTCTCCAAGGTCAAGGTGCCGCACACCTTCCTCATCCACAGCTATACACGGCCCACCGTTTGCCAGGCT
TGCAAGAAACTCCTCAAGGGCCTCTTCCGGCAGGGCCTGCAATGCAAAGACTGCAAGTTTAACTGTCACA
AACGCTGCGCCACCCGCGTCCCTAATGACTGCCTGGGGGAGGCCCTTATCAATGGAGATGTGCCGATGGA
GGAGGCCACCGATTTCAGCGAGGCTGACAAGAGCGCCCTCATGGATGAGTCAGAGGACTCCGGTGTCATC
CCTGGCTCCCACTCAGAGAATGCGCTCCACGCCAGTGAGGAGGAGGAAGGCGAGGGAGGCAAGGCCCAGA
GCTCCCTGGGGTACATCCCCCTAATGAGGGTGGTGCAATCGGTGCGACACACGACGCGGAAATCCAGCAC
CACGCTGCGGGAGGGTTGGGTGGTTCATTACAGCAACAAGGACACGCTGAGAAAGCGGCACTATTGGCGC
CTGGACTGCAAGTGTATCACGCTCTTCCAGAACAACACGACCAACAGATACTATAAGGAAATTCCGCTGT
CAGAAATCCTCACGGTGGAGTCCGCCCAGAACTTCAGCCTTGTGCCGCCGGGCACCAACCCACACTGCTT
TGAGATCGTCACTGCCAATGCCACCTACTTCGTGGGCGAGATGCCTGGCGGGACTCCGGGTGGGCCAAGT
GGGCAGGGGGCTGAGGCCGCCCGGGGCTGGGAGACAGCCATCCGCCAGGCCCTGATGCCCGTCATCCTTC
AGGACGCACCCAGCGCCCCAGGCCACGCGCCCCACAGACAAGCTTCTCTGAGCATCTCTGTGTCCAACAG
TCAGATCCAAGAGAATGTGGACATTGCCACTGTCTACCAGATCTTCCCTGACGAAGTGCTGGGCTCAGGG
CAGTTTGGAGTGGTCTATGGAGGAAAACACCGGAAGACAGGCCGGGACGTGGCAGTTAAGGTCATTGACA
AACTGCGCTTCCCTACCAAGCAGGAGAGCCAGCTCCGGAATGAAGTGGCCATTCTGCAGAGCCTGCGGCA
TCCCGGGATCGTGAACCTGGAGTGCATGTTCGAGACGCCTGAGAAAGTGTTTGTGGTGATGGAGAAGCTG
CATGGGGACATGTTGGAGATGATCCTGTCCAGTGAGAAGGGCCGGCTGCCTGAGCGCCTCACCAAGTTCC
TCATCACCCAGATCCTGGTGGCTTTGAGACACCTTCACTTCAAGAACATTGTCCACTGTGACTTGAAACC
AGAAAACGTGTTGCTGGCATCAGCAGACCCATTTCCTCAGGTGAAGCTGTGTGACTTTGGCTTTGCTCGC
ATCATCGGCGAGAAGTCGTTCCGCCGCTCAGTGGTGGGCACGCCGGCCTACCTGGCACCCGAGGTGCTGC
TCAACCAGGGCTACAACCGCTCGCTGGACATGTGGTCAGTGGGCGTGATCATGTACGTCAGCCTCAGCGG
CACCTTCCCTTTCAACGAGGATGAGGACATCAATGACCAGATCCAGAACGCCGCCTTCATGTACCCGGCC
AGCCCCTGGAGCCACATCTCAGCTGGAGCCATTGACCTCATCAACAACCTGCTGCAGGTGAAGATGCGCA
AACGCTACAGCGTGGACAAATCTCTCAGCCACCCCTGGTTACAGGAGTACCAGACGTGGCTGGACCTCCG
AGAGCTGGAGGGGAAGATGGGAGAGCGATACATCACGCATGAGAGTGACGACGCGCGCTGGGAGCAGTTT
GCAGCAGAGCATCCGCTGCCTGGGTCTGGGCTGCCCACGGACAGGGATCTCGGTGGGGCCTGTCCACCAC
AGGACCACGACATGCAGGGGCTGGCGGAGCGCATCAGTGTTCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215335 representing NM_016457
Red=Cloning site Green=Tags(s)

MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLLPAASELAHVK
QLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHA
LTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLG
TSESLPCTAEELSRSTTELLPRRPPSSSSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQA
CKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVI
PGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR
LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPS
GQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSG
QFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKL
HGDMLEMILSSEKGRLPERLTKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFAR
IIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPA
SPWSHISAGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF
AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016457
ORF Size 2634 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016457.5
RefSeq Size 2883 bp
RefSeq ORF 2637 bp
Locus ID 25865
UniProt ID Q9BZL6
Cytogenetics 19q13.32
Protein Families Druggable Genome, Protein Kinase
MW 96.5 kDa
Gene Summary The protein encoded by this gene belongs to the protein kinase D (PKD) family of serine/threonine protein kinases. This kinase can be activated by phorbol esters as well as by gastrin via the cholecystokinin B receptor (CCKBR) in gastric cancer cells. It can bind to diacylglycerol (DAG) in the trans-Golgi network (TGN) and may regulate basolateral membrane protein exit from TGN. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.