PSD95 (DLG4) (NM_001365) Human Tagged ORF Clone

CAT#: RC215178

Reviews ()
Write a review

DLG4 (Myc-DDK-tagged)-Human discs, large homolog 4 (Drosophila) (DLG4), transcript variant 1



  "NM_001365" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 702.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "DLG4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DLG4
Synonyms MRD62; PSD95; SAP-90; SAP90
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215178 representing NM_001365
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCAGAGACCAAGAGCTCCCAGGTCAGCCCTCTGGCTCCTGGCACCCCCACTGCTGCGGTGGGCAC
CCCCACTCCTCACAGTGCTGCATAGCGACCTCTTCCAGGCCTTGCTGGACATCCTGGACTATTATGAGGC
TTCCCTCTCAGAGAGTCAGAAATACCGCTACCAAGATGAAGACACGCCCCCTCTGGAGCACAGCCCGGCC
CACCTCCCCAACCAGGCCAATTCTCCCCCAGTGATTGTCAACACAGATACCCTAGAAGCCCCAGGATATG
AGTTGCAGGTGAACGGGACCGAGGGGGAGATGGAATACGAGGAAATCACATTGGAAAGGGGTAACTCAGG
TCTGGGCTTCAGCATCGCAGGTGGCACTGACAACCCACACATCGGTGACGACCCATCCATTTTCATCACC
AAGATCATTCCTGGTGGGGCTGCGGCCCAGGATGGCCGCCTCAGGGTCAACGACAGCATCCTGTTTGTAA
ATGAAGTGGACGTGCGCGAGGTGACCCACTCAGCGGCGGTGGAAGCCCTCAAAGAGGCAGGCTCCATCGT
TCGCCTCTATGTCATGCGCCGGAAGCCCCCGGCTGAGAAGGTCATGGAGATCAAGCTCATCAAGGGGCCT
AAAGGTCTTGGCTTCAGCATCGCAGGGGGCGTAGGGAACCAGCACATCCCAGGAGATAATAGCATCTATG
TAACAAAGATCATCGAAGGGGGTGCTGCCCACAAGGATGGGAGGTTGCAGATTGGAGACAAGATCCTGGC
GGTCAACAGTGTGGGGCTAGAGGACGTCATGCATGAAGATGCTGTGGCAGCCCTGAAGAACACGTATGAT
GTTGTCTACCTAAAGGTGGCCAAGCCCAGCAATGCCTACCTGAGTGACAGCTATGCTCCCCCAGACATCA
CAACCTCTTATTCCCAGCACCTGGACAATGAGATCAGTCACAGCAGCTACCTGGGCACCGACTACCCCAC
AGCCATGACCCCCACTTCCCCTCGGCGCTACTCTCCAGTGGCCAAGGACCTGCTCGGGGAGGAAGACATT
CCCCGAGAACCGAGGCGAATTGTGATCCACCGGGGCTCCACGGGCCTGGGCTTCAACATCGTGGGTGGCG
AGGACGGTGAAGGCATCTTCATCTCCTTTATCCTGGCCGGGGGCCCTGCAGACCTCAGTGGGGAGCTGCG
GAAGGGGGACCAGATCCTGTCGGTCAACGGTGTGGACCTCCGAAATGCCAGCCATGAGCAGGCTGCCATT
GCCCTGAAGAATGCGGGTCAGACGGTCACGATCATTGCTCAGTATAAACCAGAAGAGTACAGCCGATTCG
AGGCCAAGATCCACGACCTTCGGGAACAGCTCATGAACAGCAGCCTGGGCTCAGGGACTGCGTCCCTGCG
GAGCAACCCCAAAAGGGGTTTCTACATCAGGGCCCTGTTTGATTACGACAAGACCAAGGACTGCGGCTTC
CTGAGCCAGGCCCTGAGCTTCCGCTTTGGGGATGTGCTGCATGTCATCGATGCTAGTGATGAGGAGTGGT
GGCAGGCACGGCGGGTCCACTCTGACAGTGAGACCGACGACATTGGGTTCATCCCCAGCAAACGGCGGGT
TGAGCGACGAGAGTGGTCAAGGTTAAAGGCCAAGGACTGGGGCTCCAGCTCTGGATCGCAGGGTCGAGAA
GACTCGGTTCTGAGCTACGAGACAGTGACGCAGATGGAAGTGCACTATGCTCGCCCCATCATCATCCTTG
GGCCCACCAAGGACCGCGCCAACGATGATCTTCTCTCCGAGTTCCCCGACAAGTTTGGATCCTGTGTTCC
CCATACGACACGGCCCAAGCGGGAGTATGAGATAGATGGCCGGGATTACCACTTTGTGTCGTCCCGGGAG
AAAATGGAGAAGGACATTCAGGCGCACAAGTTCATTGAGGCCGGCCAGTACAACAGCCACCTCTATGGGA
CCAGCGTCCAGTCCGTGCGAGAGGTGGCAGAGCAGGGGAAGCACTGCATCCTCGATGTCTCGGCCAATGC
CGTGCGGCGGCTGCAGGCGGCCCACCTGCACCCCATCGCCATCTTCATCCGCCCCCGCTCCCTGGAGAAT
GTGCTAGAGATTAACAAGCGGATCACAGAGGAGCAAGCCCGCAAAGCCTTCGACAGAGCCACCAAGCTGG
AGCAGGAGTTCACAGAGTGCTTCTCAGCCATCGTGGAGGGTGACAGCTTTGAGGAGATCTACCACAAGGT
GAAGCGTGTCATCGAGGACCTCTCAGGCCCCTACATCTGGGTTCCAGCCCGAGAGAGACTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215178 representing NM_001365
Red=Cloning site Green=Tags(s)

MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEASLSESQKYRYQDEDTPPLEHSPA
HLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFIT
KIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGP
KGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYD
VVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDI
PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAI
ALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGF
LSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGRE
DSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSRE
KMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLEN
VLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001365
ORF Size 2301 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001365.4
RefSeq Size 3995 bp
RefSeq ORF 2304 bp
Locus ID 1742
UniProt ID P78352
Cytogenetics 17p13.1
Protein Families Druggable Genome
Protein Pathways Huntington's disease
MW 85.2 kDa
Gene Summary This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.