BAIAP2 (NM_006340) Human Tagged ORF Clone

CAT#: RC214570

Reviews ()
Write a review

BAIAP2 (Myc-DDK-tagged)-Human BAI1-associated protein 2 (BAIAP2), transcript variant 3



Reconstitution Protocol

USD 484.00

In Stock*

Size
    • 10 ug

Other products for "BAIAP2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BAIAP2
Synonyms BAP2; FLAF3; IRSP53; WAML
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214570 representing NM_006340
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCTGTCTCGCTCAGAGGAGATGCACCGGCTCACGGAAAATGTCTATAAGACCATCATGGAGCAGT
TCAACCCTAGCCTCCGGAACTTCATCGCCATGGGGAAGAATTACGAGAAGGCACTGGCAGGTGTGACGTA
TGCAGCCAAAGGCTACTTTGACGCCCTGGTGAAGATGGGGGAGCTGGCCAGCGAGAGCCAGGGCTCCAAA
GAACTCGGAGACGTTCTCTTCCAGATGGCTGAAGTCCACAGGCAGATCCAGAATCAGCTGGAAGAAATGC
TGAAGTCTTTTCACAACGAGCTGCTTACGCAGCTGGAGCAGAAGGTGGAGCTGGACTCCAGGTATCTGAG
TGCTGCGCTGAAGAAATACCAGACTGAGCAAAGGAGCAAAGGCGACGCCCTGGACAAGTGTCAGGCTGAG
CTGAAGAAGCTTCGGAAGAAGAGCCAGGGCAGCAAGAATCCTCAGAAGTACTCGGACAAGGAGCTGCAGT
ACATCGACGCCATCAGCAACAAGCAGGGCGAGCTGGAGAATTACGTGTCCGACGGCTACAAGACCGCACT
GACAGAGGAGCGCAGGCGCTTCTGCTTCCTGGTGGAGAAGCAGTGCGCCGTGGCCAAGAACTCCGCGGCC
TACCACTCCAAGGGCAAGGAGCTGCTGGCGCAGAAGCTGCCGCTGTGGCAACAGGCCTGTGCCGACCCCA
GCAAGATCCCGGAGCGCGCGGTGCAGCTCATGCAGCAGGTGGCCAGCAACGGCGCCACCCTCCCCAGCGC
CCTGTCGGCCTCCAAGTCCAACCTGGTCATTTCCGACCCCATTCCGGGGGCCAAGCCCCTGCCGGTGCCC
CCCGAGCTGGCACCGTTCGTGGGGCGGATGTCTGCCCAGGAGAGCACACCCATCATGAACGGCGTCACAG
GCCCGGATGGCGAGGACTACAGCCCGTGGGCTGACCGCAAGGCTGCCCAGCCCAAATCCCTGTCTCCTCC
GCAGTCTCAGAGCAAGCTCAGCGACTCCTACTCCAACACACTCCCCGTGCGCAAGAGCGTGACCCCAAAA
AACAGCTATGCCACCACCGAGAACAAGACTCTGCCTCGCTCGAGCTCCATGGCAGCCGGCCTGGAGCGCA
ATGGCCGTATGCGGGTGAAGGCCATCTTCTCCCACGCTGCTGGGGACAACAGCACCCTCCTGAGCTTCAA
GGAGGGTGACCTCATTACCCTGCTGGTGCCTGAGGCCCGCGATGGCTGGCACTACGGAGAGAGTGAGAAG
ACCAAGATGCGGGGCTGGTTTCCCTTCTCCTACACCCGGGTCTTGGACAGCGATGGCAGTGACAGGCTGC
ACATGAGCCTGCAGCAAGGGAAGAGCAGCAGCACGGGCAACCTCCTGGACAAGGACGACCTGGCCATCCC
ACCCCCCGATTACGGCGCCGCCTCCCGGGCCTTCCCCGCCCAGACGGCCAGCGGCTTCAAGCAGAGGCCC
TACAGTGTGGCCGTGCCCGCCTTCTCCCAGGGCCTGGATGACTATGGAGCGCGGTCCATGAGCAGCGCCG
ATGTGGAAGTGGCCAGATTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214570 representing NM_006340
Red=Cloning site Green=Tags(s)

MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSK
ELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAE
LKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAA
YHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVP
PELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPK
NSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK
TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRP
YSVAVPAFSQGLDDYGARSMSSADVEVARF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006340
ORF Size 1560 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006340.3
RefSeq Size 2129 bp
RefSeq ORF 1563 bp
Locus ID 10458
UniProt ID Q9UQB8
Cytogenetics 17q25.3
Domains SH3
Protein Families Druggable Genome
Protein Pathways Adherens junction, Regulation of actin cytoskeleton
MW 57.3 kDa
Gene Summary The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Jan 2009]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.