XAGE3 (NM_133179) Human Tagged ORF Clone

CAT#: RC214210

XAGE3 (Myc-DDK-tagged)-Human X antigen family, member 3 (XAGE3), transcript variant 1

Product Images

Circular map for RC214210

• 

  Western blot validation of overexpression lysate (Cat# LY408847) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC214210 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified XAGE3 protein (Cat# TP314210). The protein was produced from HEK293T cells transfected with XAGE3 cDNA clone (Cat# RC214210) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: XAGE3
• Synonyms: CT12.3a; CT12.3b; GAGED4; PLAC6; pp9012; XAGE-3
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC214210 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGATTTGGCGAGGAAGATCAACATATAGGCCTAGGCCGAGGAGAAGTGTACCACCTCCTGAGCTGATTG
  GGCCTATGCTGGAGCCCGGTGATGAGGAGCCTCAGCAAGAGGAACCACCAACTGAAAGTCGGGATCCTGC
  ACCTGGTCAGGAGAGAGAAGAAGATCAGGGTGCAGCTGAGACTCAAGTGCCTGACCTGGAAGCTGATCTC
  CAGGAGCTGTCTCAGTCAAAGACTGGGGGTGAATGTGGAAATGGTCCTGATGACCAGGGGAAGATTCTGC
  CAAAATCAGAACAATTTAAAATGCCAGAAGGAGGTGACAGGCAACCACAGGTT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC214210 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIWRGRSTYRPRPRRSVPPPELIGPMLEPGDEEPQQEEPPTESRDPAPGQEREEDQGAAETQVPDLEADL
  QELSQSKTGGECGNGPDDQGKILPKSEQFKMPEGGDRQPQV
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_133179
• ORF Size: 333 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_133179.3
• RefSeq Size: 543 bp
• RefSeq ORF: 336 bp
• Locus ID: 170626
• UniProt ID: Q8WTP9
• Cytogenetics: Xp11.22
• MW: 12.3 kDa
• Gene Summary: This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is expressed in placenta and fetal liver/spleen, and may function in inhibiting cancer cell growth. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. Alternative splicing of this gene generates 2 transcript variants differing in the 5' UTR. [provided by RefSeq, Jul 2008]