Zyxin (ZYX) (NM_003461) Human Tagged ORF Clone

CAT#: RC214079

Reviews ()
Write a review

ZYX (Myc-DDK-tagged)-Human zyxin (ZYX), transcript variant 1



  "NM_003461" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ZYX
Synonyms ESP-2; HED-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214079 representing NM_003461
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCCCCCGCCCGTCTCCCGCGATCTCCGTTTCGGTCTCGGCTCCGGCTTTTTACGCCCCGCAGA
AGAAGTTCGGCCCTGTGGTGGCCCCAAAGCCCAAAGTGAATCCCTTCCGGCCCGGGGACAGCGAGCCTCC
CCCGGCACCCGGGGCCCAGCGCGCACAGATGGGCCGGGTGGGCGAGATTCCCCCGCCGCCCCCGGAAGAC
TTTCCCCTGCCTCCACCTCCCCTTGCTGGGGATGGCGACGATGCAGAGGGTGCTCTGGGAGGTGCCTTCC
CGCCGCCCCCTCCCCCGATCGAGGAATCATTTCCCCCTGCGCCTCTGGAGGAGGAGATCTTCCCTTCCCC
GCCGCCTCCTCCGGAGGAGGAGGGAGGGCCTGAGGCCCCCATACCGCCCCCACCACAGCCCAGGGAGAAG
GTGAGCAGTATTGATTTGGAGATCGACTCTCTGTCCTCACTGCTGGATGACATGACCAAGAATGATCCTT
TCAAAGCCCGGGTGTCATCTGGATATGTGCCCCCACCAGTGGCCACTCCATTCAGTTCCAAGTCCAGTAC
CAAGCCTGCAGCCGGGGGCACAGCACCCCTGCCTCCTTGGAAGTCCCCTTCCAGCTCCCAGCCTCTGCCC
CAGGTTCCGGCTCCGGCTCAGAGCCAGACACAGTTCCATGTTCAGCCCCAGCCCCAGCCCAAGCCTCAGG
TCCAACTCCATGTCCAGTCCCAGACCCAGCCTGTGTCTTTGGCTAACACCCAGCCCCGAGGGCCCCCAGC
CTCATCTCCGGCTCCAGCCCCTAAGTTTTCTCCAGTGACTCCTAAGTTTACTCCTGTGGCTTCCAAGTTC
AGTCCTGGAGCCCCAGGTGGATCTGGGTCACAACCAAATCAAAAATTGGGGCACCCCGAAGCTCTTTCTG
CTGGCACAGGCTCCCCTCAACCTCCCAGCTTCACCTATGCCCAGCAGAGGGAGAAGCCCCGAGTGCAGGA
GAAGCAGCACCCCGTGCCCCCACCGGCTCAGAACCAAAACCAGGTGCGCTCCCCTGGGGCCCCAGGGCCC
CTGACTCTGAAGGAGGTGGAGGAGCTGGAGCAGCTGACCCAGCAGCTAATGCAGGACATGGAGCATCCTC
AGAGGCAGAATGTGGCTGTCAACGAACTCTGCGGCCGATGCCATCAACCCCTGGCCCGGGCGCAGCCAGC
CGTCCGCGCTCTAGGGCAGCTGTTCCACATCGCCTGCTTCACCTGCCACCAGTGTGCGCAGCAGCTCCAG
GGCCAGCAGTTCTACAGTCTGGAGGGGGCGCCGTACTGCGAGGGCTGTTACACTGACACCCTGGAGAAGT
GTAACACCTGCGGGGAGCCCATCACTGACCGCATGCTGAGGGCCACGGGCAAGGCCTATCACCCGCACTG
CTTCACCTGTGTGGTCTGCGCCCGCCCCCTGGAGGGCACCTCCTTCATCGTGGACCAGGCCAACCGGCCC
CACTGTGTCCCCGACTACCACAAGCAGTACGCCCCGAGGTGCTCCGTCTGCTCTGAGCCCATCATGCCTG
AGCCTGGCCGAGATGAGACTGTGCGAGTGGTCGCCCTGGACAAGAACTTCCACATGAAGTGTTACAAGTG
TGAGGACTGCGGGAAGCCCCTGTCGATTGAGGCAGATGACAATGGCTGCTTCCCCCTGGACGGTCACGTG
CTCTGTCGGAAGTGCCACACTGCTAGAGCCCAGACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214079 representing NM_003461
Red=Cloning site Green=Tags(s)

MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPED
FPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREK
VSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLP
QVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKF
SPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGP
LTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQ
GQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRP
HCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHV
LCRKCHTARAQT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003461
ORF Size 1716 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003461.5
RefSeq Size 2325 bp
RefSeq ORF 1719 bp
Locus ID 7791
UniProt ID Q15942
Cytogenetics 7q34
Domains LIM
Protein Pathways Focal adhesion
MW 61.1 kDa
Gene Summary Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles. Alternative splicing results in multiple transcript variants that encode the same isoform. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


ZYX rabbit polyclonal antibody
    • 100 ul

USD 380.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.