TNNT3 (NM_001042780) Human Tagged ORF Clone

CAT#: RC212563

TNNT3 (Myc-DDK-tagged)-Human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3

Product Images

Circular map for RC212563

• 

  Western blot validation of overexpression lysate (Cat# LY420809) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC212563 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified TNNT3 protein (Cat# TP312563). The protein was produced from HEK293T cells transfected with TNNT3 cDNA clone (Cat# RC212563) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: TNNT3
• Synonyms: beta-TnTF; DA2B2; TNTF
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC212563 representing NM_001042780
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCTGACGAGGAAGTTGAACAGGTGGAGGAGCAGTACGAAGAAGAAGAGGAAGCCCAGGAGGAAGAGG
  AAGTTCAAGAAGAGGAGAAACCGAGACCCAAACTCACTGCTCCTAAGATCCCAGAAGGGGAGAAAGTGGA
  CTTCGATGACATCCAGAAGAAGCGTCAGAACAAAGACCTAATGGAGCTCCAGGCCCTCATCGACAGCCAC
  TTTGAAGCCCGGAAGAAGGAGGAGGAGGAGCTGGTCGCTCTCAAAGAGAGAATCGAGAAGCGCCGTGCAG
  AGAGAGCGGAGCAGCAGAGGATTCGTGCAGAGAAGGAGAGGGAGCGCCAGAACAGACTGGCGGAGGAAAA
  GGCCAGAAGGGAGGAGGAGGATGCCAAGAGGAGGGCAGAGGACGACCTGAAGAAGAAGAAAGCTCTGTCT
  TCCATGGGAGCCAACTACAGCAGCTACCTGGCCAAGGCTGACCAGAAGAGAGGCAAGAAGCAGACAGCCC
  GGGAAATGAAGAAGAAGATTCTGGCTGAGAGACGCAAGCCGCTCAACATCGATCACCTTGGTGAAGACAA
  ACTGAGGGACAAGGCCAAGGAGCTCTGGGAGACCCTGCACCAGCTGGAGATTGACAAGTTCGAGTTTGGG
  GAGAAGCTGAAACGCCAGAAATATGACATCATGAATGTCCGGGCCAGAGTGCAGATGCTGGCCAAGTTCA
  GCAAGAAGGCTGGGACCCCAGCCAAGGGCAAAGTCGGCGGGCGCTGGAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC212563 representing NM_001042780
  Red=Cloning site Green=Tags(s)
  
  MSDEEVEQVEEQYEEEEEAQEEEEVQEEEKPRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSH
  FEARKKEEEELVALKERIEKRRAERAEQQRIRAEKERERQNRLAEEKARREEEDAKRRAEDDLKKKKALS
  SMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFG
  EKLKRQKYDIMNVRARVQMLAKFSKKAGTPAKGKVGGRWK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001042780
• ORF Size: 750 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001042780.3
• RefSeq Size: 1193 bp
• RefSeq ORF: 753 bp
• Locus ID: 7140
• UniProt ID: P45378
• Cytogenetics: 11p15.5
• MW: 30.2 kDa
• Gene Summary: The binding of Ca(2+) to the trimeric troponin complex initiates the process of muscle contraction. Increased Ca(2+) concentrations produce a conformational change in the troponin complex that is transmitted to tropomyosin dimers situated along actin filaments. The altered conformation permits increased interaction between a myosin head and an actin filament which, ultimately, produces a muscle contraction. The troponin complex has protein subunits C, I, and T. Subunit C binds Ca(2+) and subunit I binds to actin and inhibits actin-myosin interaction. Subunit T binds the troponin complex to the tropomyosin complex and is also required for Ca(2+)-mediated activation of actomyosin ATPase activity. There are 3 different troponin T genes that encode tissue-specific isoforms of subunit T for fast skeletal-, slow skeletal-, and cardiac-muscle. This gene encodes fast skeletal troponin T protein; also known as troponin T type 3. Alternative splicing results in multiple transcript variants encoding additional distinct troponin T type 3 isoforms. A developmentally regulated switch between fetal/neonatal and adult troponin T type 3 isoforms occurs. Additional splice variants have been described but their biological validity has not been established. Mutations in this gene may cause distal arthrogryposis multiplex congenita type 2B (DA2B). [provided by RefSeq, Oct 2009]