DAOA (NM_172370) Human Tagged ORF Clone

CAT#: RC212162

DAOA (Myc-DDK-tagged)-Human D-amino acid oxidase activator (DAOA), transcript variant 1

Product Images

Circular map for RC212162

• 

  Western blot validation of overexpression lysate (Cat# LY406698) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC212162 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: DAOA
• Synonyms: LG72; SG72
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC212162 representing NM_172370
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCTGGAAAAGCTGATGGGTGCTGATTCTCTCCAGCTTTTCAGATCCAGATATACATTGGGTAAAATCT
  ACTTCATAGGTTTTCAAAAGAGCATTCTTCTGAGCAAATCTGAAAACTCTCTAAACTCTATTGCAAAGGA
  GACAGAAGAAGGAAGAGAGACGGTAACAAGGAAAGAAGGATGGAAGAGAAGGCATGAGGACGGCTATTTG
  GAAATGGCACAGAGGCATTTACAGAGATCATTATGTCCTTGGGTCTCTTACCTTCCTCAGCCCTATGCAG
  AGCTTGAAGAAGTAAGCAGCCATGTTGGAAAAGTCTTCATGGCAAGAAACTATGAGTTCCTTGCCTATGA
  GGCCTCTAAGGACCGCAGGCAGCCTCTAGAACGAATGTGGACCTGCAACTACAACCAGCAAAAAGACCAG
  TCATGCAACCACAAGGAAATAACTTCTACCAAAGCTGAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC212162 representing NM_172370
  Red=Cloning site Green=Tags(s)
  
  MLEKLMGADSLQLFRSRYTLGKIYFIGFQKSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYL
  EMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQ
  SCNHKEITSTKAE
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_172370
• ORF Size: 459 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_172370.2, NP_758958.2
• RefSeq Size: 742 bp
• RefSeq ORF: 462 bp
• Locus ID: 267012
• UniProt ID: P59103
• Cytogenetics: 13q34
• Protein Families: Druggable Genome
• MW: 17.9 kDa
• Gene Summary: This gene encodes a protein that may function as an activator of D-amino acid oxidase, which degrades the gliotransmitter D-serine, a potent activator of N-methyl-D-aspartate (NMDA) type glutamate receptors. Studies also suggest that one encoded isoform may play a role in mitochondrial function and dendritic arborization. Polymorphisms in this gene have been implicated in susceptibility to schizophrenia and bipolar affective disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Mar 2011]