DAOA (NM_172370) Human Tagged ORF Clone

CAT#: RC212162

DAOA (Myc-DDK-tagged)-Human D-amino acid oxidase activator (DAOA), transcript variant 1

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DAOA (NM_172370) Human Tagged ORF Clone
Symbol DAOA
Synonyms LG72; SG72
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC212162 representing NM_172370
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGAAAAGCTGATGGGTGCTGATTCTCTCCAGCTTTTCAGATCCAGATATACATTGGGTAAAATCT
ACTTCATAGGTTTTCAAAAGAGCATTCTTCTGAGCAAATCTGAAAACTCTCTAAACTCTATTGCAAAGGA
GACAGAAGAAGGAAGAGAGACGGTAACAAGGAAAGAAGGATGGAAGAGAAGGCATGAGGACGGCTATTTG
GAAATGGCACAGAGGCATTTACAGAGATCATTATGTCCTTGGGTCTCTTACCTTCCTCAGCCCTATGCAG
AGCTTGAAGAAGTAAGCAGCCATGTTGGAAAAGTCTTCATGGCAAGAAACTATGAGTTCCTTGCCTATGA
GGCCTCTAAGGACCGCAGGCAGCCTCTAGAACGAATGTGGACCTGCAACTACAACCAGCAAAAAGACCAG
TCATGCAACCACAAGGAAATAACTTCTACCAAAGCTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212162 representing NM_172370
Red=Cloning site Green=Tags(s)

MLEKLMGADSLQLFRSRYTLGKIYFIGFQKSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYL
EMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQ
SCNHKEITSTKAE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_172370
ORF Size 459 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_172370.2, NM_172370.3, NM_172370.4, NP_758958
RefSeq Size 742
RefSeq ORF 462
Locus ID 267012
Cytogenetics 13q33.2|13q34
Protein Families Druggable Genome
MW 17.9 kDa
Gene Summary This gene encodes a protein that may function as an activator of D-amino acid oxidase, which degrades the gliotransmitter D-serine, a potent activator of N-methyl-D-aspartate (NMDA) type glutamate receptors. Studies also suggest that one encoded isoform may play a role in mitochondrial function and dendritic arborization. Polymorphisms in this gene have been implicated in susceptibility to schizophrenia and bipolar affective disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Mar 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)