OR2W5 (NM_001004698) Human Tagged ORF Clone

CAT#: RC211762

OR2W5 (Myc-DDK-tagged)-Human olfactory receptor, family 2, subfamily W, member 5 (OR2W5)

Product Images

Circular map for RC211762

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: OR2W5
• Synonyms: OR2W5P; OST722
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC211762 representing NM_001004698
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGAAAGGACAATGCCAGTTACCTACAGGCATTCATCCTGGTGGGCTCTTCTGATCGGCCTGGACTGG
  AGAAAATTCTCTTTGCTGTTATCTTGATCTTCTGCATCCTGACCCTGGTGGGCAACACTGCCATCATCCT
  CTTGCTGGTCATGGATGTCAGGCTCCACACACCCATGTACTTCTTTCTTGGGAATCTGTCTTTCTTAGAT
  CTCTGCTTTACAGCAAGCATTGCCCCTCAGCTGCTGTGGAACCTGGGGGGTCCAGAGAAGACCATCACCT
  ACCACGGCTGTGTGGCCCAACTCTACATCTACATGATGCTGGGCTCCACCGAGTGCGTCCTCCTGGTTGT
  CATGTCCCATGACCGCTATGTGGCCGTCTGCCGGTCCCTGCACTACATGGCAGTCATGCGCCCACATCTC
  TGCCTGCAGCTGGTGACTGTGGCCTGGTGCTGTGGCTTCCTAAACTCCTTCATCATGTGTCCTCAGACGA
  TGCAGCTCTCCCGGTGTGGACGTCGCAGGGTGGACCACTTCCTGTGTGAGATGCCTGCTCTTATTGCCAT
  GTCTTGTGAGGAAACCATGCTGGTAGAAGCGATTCACCTTTGCCCTGGGGGTGGCTCTCCTCCTGGTGCC
  GCTCTCCCTCATCCTCATCTCCTATGGCGTGATTGCAGCCGCGGTGCTGAGGATGAAGTCAGCAGCAGGG
  CGAAAGAAAGCCTTCCACACCTGCTCTTCTCACCTCACAGTGGTCTCTCTCTTCTACGGAACCATCATCT
  ACGTGTACCTGAAGCCGGCCAACAGCTACTCCCAAGATCAGGGGAAGTTCCTGACTCTCTTCTACACCAT
  CGTCATTCCCAGCATCAACCCCCTCATCTACACTTTGAGGAACAAGGATGTGAAGGGGACCATGAAGAAA
  CTTCTGGGGTGGGAGAAAGGGGCTGGGGAGCCTCAACGAGGGGAACACTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC211762 representing NM_001004698
  Red=Cloning site Green=Tags(s)
  
  MGKDNASYLQAFILVGSSDRPGLEKILFAVILIFCILTLVGNTAIILLLVMDVRLHTPMYFFLGNLSFLD
  LCFTASIAPQLLWNLGGPEKTITYHGCVAQLYIYMMLGSTECVLLVVMSHDRYVAVCRSLHYMAVMRPHL
  CLQLVTVAWCCGFLNSFIMCPQTMQLSRCGRRRVDHFLCEMPALIAMSCEETMLVEAIHLCPGGGSPPGA
  ALPHPHLLWRDCSRGAEDEVSSRAKESLPHLLFSPHSGLSLLRNHHLRVPEAGQQLLPRSGEVPDSLLHH
  RHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGTL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001004698
• ORF Size: 960 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001004698.2, NP_001004698.1
• RefSeq Size: 963 bp
• RefSeq ORF: 963 bp
• Locus ID: 441932
• UniProt ID: A6NFC9
• Cytogenetics: 1q44
• Protein Families: Transmembrane
• MW: 35.3 kDa
• Gene Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This olfactory receptor gene has a coding sequence that is comparable in length to other olfactory receptor genes, but it should be noted that a frameshift is present in the 3' coding region that disrupts the 7-transmembrane domain structure in the protein. It is unclear if the protein can function as an olfactory receptor or if an alternate function is served. For this reason, this gene has also been interpreted to be a pseudogene. [provided by RefSeq, Jan 2010]