PTPLAD2 (HACD4) (NM_001010915) Human Tagged ORF Clone

CAT#: RC211059

PTPLAD2 (Myc-DDK-tagged)-Human protein tyrosine phosphatase-like A domain containing 2 (PTPLAD2)

Product Images

Circular map for RC211059

• 

  Western blot validation of overexpression lysate (Cat# LY423227) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC211059 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: PTPLAD2
• Synonyms: PTPLAD2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC211059 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGGCCCTTGGCGCTGCCCGCCTGGCTGCAGCCCAGGTATAGGAAGAATGCGTATCTTTTCATCTATT
  ACTTAATCCAGTTCTGTGGCCACTCTTGGATATTTACAAATATGACAGTCAGATTCTTTTCATTTGGAAA
  AGATTCAATGGTTGACACTTTTTATGCTATTGGACTTGTGATGCGACTTTGCCAATCCGTATCTCTCCTG
  GAACTGCTGCACATATATGTTGGCATTGAGTCAAACCATCTTCTCCCAAGGTTTTTGCAGCTCACAGAAA
  GAATAATCATCCTTTTTGTGGTGATCACCAGTCAAGAGGAAGTCCAAGAGAAATATGTGGTGTGTGTTTT
  ATTCGTCTTTTGGAATCTATTGGATATGGTTAGGTACACTTATAGCATGTTATCAGTCATAGGAATATCC
  TATGCTGTCTTGACATGGCTCAGTCAAACACTATGGATGCCAATTTATCCTTTGTGTGTTCTTGCTGAAG
  CATTTGCCATCTATCAATCGCTGCCTTATTTTGAATCATTTGGCACTTATTCCACCAAGCTGCCCTTTGA
  CTTATCCATCTATTTCCCATATGTGCTGAAAATATATCTCATGATGCTCTTTATAGGTATGTATTTTACC
  TACAGTCATCTATACTCAGAAAGAAGAGACATCCTCGGAATCTTTCCCATTAAAAAAAAGAAGATG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC211059 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGPLALPAWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLVMRLCQSVSLL
  ELLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFWNLLDMVRYTYSMLSVIGIS
  YAVLTWLSQTLWMPIYPLCVLAEAFAIYQSLPYFESFGTYSTKLPFDLSIYFPYVLKIYLMMLFIGMYFT
  YSHLYSERRDILGIFPIKKKKM
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001010915
• ORF Size: 696 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001010915.5
• RefSeq Size: 1416 bp
• RefSeq ORF: 699 bp
• Locus ID: 401494
• UniProt ID: Q5VWC8
• Cytogenetics: 9p21.3
• Protein Families: Transmembrane
• MW: 27.5 kDa
• Gene Summary: Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.[UniProtKB/Swiss-Prot Function]