ZSCAN4 (NM_152677) Human Tagged ORF Clone

CAT#: RC211003

Reviews ()
Write a review

ZSCAN4 (Myc-DDK-tagged)-Human zinc finger and SCAN domain containing 4 (ZSCAN4)



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "ZSCAN4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ZSCAN4
Synonyms ZNF494
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC211003 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTTAGATCTAAGAACCATATTTCAGTGTGAACCATCCGAGAATAATCTTGGATCAGAAAATTCAG
CGTTTCAACAAAGCCAAGGACCTGCTGTTCAGAGAGAAGAAGGGATTTCTGAGTTCTCAAGAATGGTGCT
CAATTCATTTCAAGACAGCAATAATTCATATGCAAGGCAGGAATTGCAAAGACTTTATAGGATCTTTCAC
TCATGGCTGCAACCAGAAAAGCACAGCAAGGATGAAATTATTTCTCTATTAGTCCTGGAGCAGTTTATGA
TTGGTGGCCACTGCAATGACAAAGCCAGTGTGAAAGAGAAATGGAAATCAAGTGGCAAAAACTTGGAGAG
ATTCATAGAAGACCTGACTGATGACAGCATAAATCCACCTGCCTTAGTCCACGTCCACATGCAGGGACAG
GAAGCTCTCTTTTCTGAGGATATGCCCTTAAGAGATGTCATTGTTCATCTCACAAAACAAGTGAATGCCC
AAACCACAAGAGAAGCAAACATGGGGACACCCTCCCAGACTTCCCAAGATACTTCCTTAGAAACAGGACA
AGGATATGAAGATGAACAAGATGGCTGGAACAGTTCTTCGAAAACTACTCGAGTAAATGAAAATATTACT
AATCAAGGCAATCAAATAGTTTCCCTAATCATCATCCAGGAAGAGAACGGTCCTAGGCCTGAAGAGGGAG
GTGTTTCTTCTGACAACCCATACAACTCAAAAAGAGCAGAGCTAGTCACTGCTAGATCTCAGGAAGGGTC
CATAAATGGAATCACTTTCCAAGGTGTCCCTATGGTGATGGGAGCAGGGTGTATCTCTCAACCAGAGCAG
TCCTCCCCTGAGTCTGCCCTTACCCACCAGAGCAATGAGGGAAATTCCACATGTGAGGTACATCAGAAAG
GATCCCATGGAGTCCAAAAATCATACAAATGTGAAGAATGCCCCAAGGTCTTTAAGTATCTCTGTCACTT
ATTAGCTCACCAGAGAAGACACAGGAATGAGAGGCCATTTGTTTGTCCCGAGTGTCAAAAAGGCTTCTTC
CAGATATCAGACCTACGGGTGCATCAGATAATTCACACAGGAAAGAAGCCTTTCACATGCAGCATGTGTA
AAAAGTCCTTCAGCCACAAAACCAACCTGCGGTCTCATGAGAGAATCCACACAGGAGAAAAGCCTTATAC
ATGTCCCTTTTGTAAGACAAGCTACCGCCAGTCATCCACATACCACCGCCATATGAGGACTCATGAGAAA
ATTACCCTGCCAAGTGTTCCCTCCACACCAGAAGCTTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211003 protein sequence
Red=Cloning site Green=Tags(s)

MALDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQELQRLYRIFH
SWLQPEKHSKDEIISLLVLEQFMIGGHCNDKASVKEKWKSSGKNLERFIEDLTDDSINPPALVHVHMQGQ
EALFSEDMPLRDVIVHLTKQVNAQTTREANMGTPSQTSQDTSLETGQGYEDEQDGWNSSSKTTRVNENIT
NQGNQIVSLIIIQEENGPRPEEGGVSSDNPYNSKRAELVTARSQEGSINGITFQGVPMVMGAGCISQPEQ
SSPESALTHQSNEGNSTCEVHQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFF
QISDLRVHQIIHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRHMRTHEK
ITLPSVPSTPEAS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_152677
ORF Size 1299 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_152677.2, NP_689890.1
RefSeq Size 2260 bp
RefSeq ORF 1302 bp
Locus ID 201516
UniProt ID Q8NAM6
Cytogenetics 19q13.43
Protein Families Transcription Factors
MW 49 kDa
Gene Summary The ZSCAN4 gene encodes a protein involved in telomere maintenance and with a key role in the critical feature of mouse embryonic stem (ES) cells, namely, defying cellular senescence and maintaining normal karyotype for many cell divisions in culture (Zalzman et al., 2010 [PubMed 20336070]).[supplied by OMIM, May 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.