GIRK2 (KCNJ6) (NM_002240) Human Tagged ORF Clone

CAT#: RC210938

Reviews ()
Write a review

KCNJ6 (Myc-DDK-tagged)-Human potassium inwardly-rectifying channel, subfamily J, member 6 (KCNJ6)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCNJ6
Synonyms BIR1; GIRK-2; GIRK2; hiGIRK2; KATP-2; KATP2; KCNJ7; KIR3.2; KPLBS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210938 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAGCTGACAGAATCCATGACTAACGTCCTGGAGGGCGACTCCATGGATCAGGACGTCGAAAGCC
CAGTGGCCATTCACCAGCCAAAGTTGCCTAAGCAGGCCAGGGATGACCTGCCAAGACACATCAGCCGAGA
TCGGACCAAAAGGAAAATCCAGAGGTACGTGAGGAAAGACGGAAAGTGCAATGTTCATCACGGCAACGTG
AGGGAGACCTATCGCTACCTGACCGATATCTTCACCACATTAGTGGACCTGAAGTGGAGATTCAACCTAT
TGATTTTTGTCATGGTTTACACAGTGACCTGGCTCTTTTTTGGAATGATCTGGTGGTTGATCGCATACAT
ACGGGGAGACATGGACCACATAGAGGACCCCTCCTGGACTCCTTGTGTTACCAACCTCAACGGGTTCGTC
TCTGCTTTTTTATTCTCAATAGAGACAGAAACCACCATTGGTTATGGCTACCGGGTCATCACAGATAAAT
GCCCGGAGGGAATTATTCTTCTCTTAATCCAATCTGTGTTGGGGTCCATTGTCAATGCATTCATGGTGGG
ATGCATGTTTGTAAAAATCTCTCAACCCAAGAAGAGGGCAGAGACCCTGGTCTTTTCCACCCATGCAGTG
ATCTCCATGCGGGATGGGAAACTGTGCCTGATGTTCCGGGTAGGGGACCTTAGGAATTCCCACATTGTGG
AGGCTTCCATCAGAGCCAAGTTGATCAAATCCAAACAGACCTCGGAGGGGGAGTTCATCCCGTTGAACCA
GACGGATATCAACGTAGGGTATTACACGGGGGATGACCGTCTGTTTCTGGTGTCACCGCTGATCATTAGC
CATGAAATTAACCAACAGAGTCCTTTCTGGGAGATCTCCAAAGCCCAGCTGCCCAAAGAGGAACTGGAAA
TTGTGGTCATCCTAGAAGGAATGGTGGAAGCCACAGGGATGACATGCCAAGCTCGAAGCTCCTACATCAC
CAGTGAGATCCTGTGGGGTTACCGGTTCACACCTGTCCTGACCCTGGAGGACGGGTTCTACGAAGTTGAC
TACAACAGCTTCCATGAGACCTATGAGACCAGCACCCCATCCCTTAGTGCCAAAGAGCTGGCCGAGTTAG
CCAGCAGGGCAGAGCTGCCCCTGAGTTGGTCTGTATCCAGCAAACTCAACCAACATGCAGAACTGGAGAC
TGAAGAGGAAGAAAAGAACCTCGAAGAGCAAACAGAAAGAAATGGTGATGTGGCAAACCTGGAGAATGAA
TCCAAAGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210938 protein sequence
Red=Cloning site Green=Tags(s)

MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGNV
RETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGDMDHIEDPSWTPCVTNLNGFV
SAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSIVNAFMVGCMFVKISQPKKRAETLVFSTHAV
ISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIIS
HEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVD
YNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENE
SKV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002240
ORF Size 1269 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002240.5
RefSeq Size 2537 bp
RefSeq ORF 1272 bp
Locus ID 3763
UniProt ID P48051
Cytogenetics 21q22.13
Domains IRK
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
MW 48.5 kDa
Gene Summary This gene encodes a member of the G protein-coupled inwardly-rectifying potassium channel family of inward rectifier potassium channels. This type of potassium channel allows a greater flow of potassium into the cell than out of it. These proteins modulate many physiological processes, including heart rate in cardiac cells and circuit activity in neuronal cells, through G-protein coupled receptor stimulation. Mutations in this gene are associated with Keppen-Lubinsky Syndrome, a rare condition characterized by severe developmental delay, facial dysmorphism, and intellectual disability. [provided by RefSeq, Apr 2015]
Other products for "KCNJ6"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.