SFRS9 (SRSF9) (NM_003769) Human Tagged ORF Clone

CAT#: RC210898

SRSF9 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 9 (SRSF9)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_003769" in other vectors (6)

Reconstitution Protocol

USD 450.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


SRSF9 mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)
    • 100 ul

USD 447.00

Other products for "SFRS9"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SFRS9
Synonyms SFRS9; SRp30c
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210898 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGGCTGGGCGGACGAGCGCGGCGGCGAGGGCGACGGGCGCATCTACGTGGGGAACCTTCCGACCG
ACGTGCGCGAGAAGGACTTGGAGGACCTGTTCTACAAGTACGGCCGCATCCGCGAGATCGAGCTCAAGAA
CCGGCACGGCCTCGTGCCCTTCGCCTTCGTGCGCTTCGAGGACCCCCGAGATGCAGAGGATGCTATTTAT
GGAAGAAATGGTTATGATTATGGCCAGTGTCGGCTTCGTGTGGAGTTCCCCAGGACTTATGGAGGTCGGG
GTGGGTGGCCCCGTGGTGGGAGGAATGGGCCTCCTACAAGAAGATCTGATTTCCGAGTTCTTGTTTCAGG
ACTTCCTCCGTCAGGCAGCTGGCAGGACCTGAAGGATCACATGCGAGAAGCTGGGGATGTCTGTTATGCT
GATGTGCAGAAGGATGGAGTGGGGATGGTCGAGTATCTCAGAAAAGAAGACATGGAATATGCCCTGCGTA
AACTGGATGACACCAAATTCCGCTCTCATGAGGGTGAAACTTCCTACATCCGAGTTTATCCTGAGAGAAG
CACCAGCTATGGCTACTCACGGTCTCGGTCTGGGTCAAGGGGCCGTGACTCTCCATACCAAAGCAGGGGT
TCCCCACACTACTTCTCTCCTTTCAGGCCCTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210898 protein sequence
Red=Cloning site Green=Tags(s)

MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIY
GRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYA
DVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRG
SPHYFSPFRPY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003769
ORF Size 663 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003769.3
RefSeq Size 1204 bp
RefSeq ORF 666 bp
Locus ID 8683
UniProt ID Q13242
Cytogenetics 12q24.31
Domains RRM
Protein Families Druggable Genome
Protein Pathways Spliceosome
MW 25.5 kDa
Gene Summary The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two pseudogenes, one on chromosome 15 and the other on chromosome 21, have been found for this gene. [provided by RefSeq, Sep 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.