Cyclin D2(CCND2) (NM_001759) Human Tagged ORF Clone

CAT#: RC210316

CCND2 (Myc-DDK-tagged)-Human cyclin D2 (CCND2)

Need custom modification / cloning service?
Get a free quote

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name Cyclin D2(CCND2) (NM_001759) Human Tagged ORF Clone
Symbol CCND2
Synonyms KIAK0002; MPPH3
Vector pCMV6-Entry
Sequence Data
>RC210316 representing NM_001759
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGCTGTGCCACGAGGTGGACCCGGTCCGCAGGGCCGTGCGGGACCGCAACCTGCTCCGAGACG
ACCGCGTCCTGCAGAACCTGCTCACCATCGAGGAGCGCTACCTTCCGCAGTGCTCCTACTTCAAGTGCGT
GCAGAAGGACATCCAACCCTACATGCGCAGAATGGTGGCCACCTGGATGCTGGAGGTCTGTGAGGAACAG
AAGTGCGAAGAAGAGGTCTTCCCTCTGGCCATGAATTACCTGGACCGTTTCTTGGCTGGGGTCCCGACTC
CGAAGTCCCATCTGCAACTCCTGGGTGCTGTCTGCATGTTCCTGGCCTCCAAACTCAAAGAGACCAGCCC
GCTGACCGCGGAGAAGCTGTGCATTTACACCGACAACTCCATCAAGCCTCAGGAGCTGCTGGAGTGGGAA
CTGGTGGTGCTGGGGAAGTTGAAGTGGAACCTGGCAGCTGTCACTCCTCATGACTTCATTGAGCACATCT
TGCGCAAGCTGCCCCAGCAGCGGGAGAAGCTGTCTCTGATCCGCAAGCATGCTCAGACCTTCATTGCTCT
GTGTGCCACGGACTTTAAGTTTGCCATGTACCCACCGTCGATGATCGCAACTGGAAGTGTGGGAGCAGCC
ATCTGTGGGCTCCAGCAGGATGAGGAAGTGAGCTCGCTCACTTGTGATGCCCTGACTGAGCTGCTGGCTA
AGATCACCAACACAGACGTGGATTGTCTCAAAGCTTGCCAGGAGCAGATTGAGGCGGTGCTCCTCAATAG
CCTGCAGCAGTACCGTCAGGACCAACGTGACGGATCCAAGTCGGAGGATGAACTGGACCAAGCCAGCACC
CCTACAGACGTGCGGGATATCGACCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210316 representing NM_001759
Red=Cloning site Green=Tags(s)

MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQ
KCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWE
LVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAA
ICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQAST
PTDVRDIDL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001759
ORF Size 867 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001759.1, NM_001759.2, NM_001759.3, NP_001750
RefSeq Size 6480
RefSeq ORF 870
Locus ID 894
Cytogenetics 12p13.32
Domains cyclin_C, CYCLIN, cyclin
Protein Families Druggable Genome
Protein Pathways Cell cycle, p53 signaling pathway, Wnt signaling pathway, Focal adhesion, Jak-STAT signaling pathway
MW 32.9 kDa
Gene Summary The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK4 or CDK6 and functions as a regulatory subunit of the complex, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. Mutations in this gene are associated with megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 3 (MPPH3). [provided by RefSeq, Sep 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)