OTUB2 (NM_023112) Human Tagged ORF Clone

CAT#: RC209650

OTUB2 (Myc-DDK-tagged)-Human OTU domain, ubiquitin aldehyde binding 2 (OTUB2)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_023112" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


OTUB2 mouse monoclonal antibody, clone OTI11B3 (formerly 11B3)
    • 100 ul

USD 447.00

Other products for "OTUB2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol OTUB2
Synonyms C14orf137; OTB2; OTU2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209650 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGAAACATCTTTCAACCTAATATCAGAAAAATGTGACATTCTATCCATTCTTCGGGACCATCCTG
AAAACAGGATTTACCGGAGGAAAATCGAGGAACTCAGCAAAAGGTTCACCGCCATCCGCAAGACCAAAGG
GGATGGGAACTGCTTCTACAGGGCCTTGGGCTATTCCTACCTGGAGTCCCTGCTGGGGAAGAGCAGGGAG
ATCTTCAAGTTCAAAGAACGCGTACTGCAGACCCCAAATGACCTTCTGGCTGCTGGCTTTGAGGAGCACA
AGTTCAGAAACTTCTTCAATGCTTTTTACAGTGTGGTGGAACTGGTAGAGAAGGACGGCTCAGTGTCCAG
CCTGCTGAAGGTGTTCAACGACCAGAGTGCCTCGGACCACATCGTGCAGTTCCTGCGCCTGCTCACGTCG
GCCTTCATCAGGAACCGAGCAGACTTCTTCCGGCACTTCATTGATGAGGAGATGGACATCAAAGACTTCT
GCACTCACGAAGTAGAGCCCATGGCCACGGAGTGTGACCACATCCAGATCACGGCGTTGTCGCAGGCCCT
GAGCATTGCCCTGCAAGTGGAGTACGTGGACGAGATGGATACCGCCCTGAACCACCACGTGTTCCCTGAG
GCCGCCACCCCTTCCGTTTACCTGCTCTATAAAACATCCCACTACAACATCCTTTATGCAGCCGATAAAC
AT


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC209650 protein sequence
Red=Cloning site Green=Tags(s)

MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSRE
IFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS
AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPE
AATPSVYLLYKTSHYNILYAADKH

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_023112
ORF Size 702 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_023112.1
RefSeq Size 3873 bp
RefSeq ORF 705 bp
Locus ID 78990
UniProt ID Q96DC9
Cytogenetics 14q32.12
Protein Families Protease
MW 27.2 kDa
Gene Summary This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain. [provided by RefSeq, Aug 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.