NOP10 (NM_018648) Human Tagged ORF Clone
CAT#: RC209038
NOP10 (Myc-DDK-tagged)-Human NOP10 ribonucleoprotein homolog (yeast) (NOP10)
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_018648" in other vectors (4)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | NOP10 |
Synonyms | DKCB1; NOLA3; NOP10P |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC209038 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTTCTCCAGTATTACCTCAACGAGCAGGGAGATCGAGTCTATACGCTGAAGAAATTTGACCCGATGG GACAACAGACCTGCTCAGCCCATCCTGCTCGGTTCTCCCCAGATGACAAATACTCTCGACACCGAATCAC CATCAAGAAACGCTTCAAGGTGCTCATGACCCAGCAACCGCGCCCTGTCCTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC209038 protein sequence
Red=Cloning site Green=Tags(s) MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_018648 |
ORF Size | 192 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_018648.4 |
RefSeq Size | 552 bp |
RefSeq ORF | 195 bp |
Locus ID | 55505 |
UniProt ID | Q9NPE3 |
Cytogenetics | 15q14 |
MW | 7.7 kDa |
Gene Summary | This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA2 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nop10p. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC209038L3 | Lenti ORF clone of Human NOP10 ribonucleoprotein homolog (yeast) (NOP10), Myc-DDK-tagged |
USD 450.00 |
|
RC209038L4 | Lenti ORF clone of Human NOP10 ribonucleoprotein homolog (yeast) (NOP10), mGFP tagged |
USD 450.00 |
|
RG209038 | NOP10 (tGFP-tagged) - Human NOP10 ribonucleoprotein homolog (yeast) (NOP10) |
USD 350.00 |
|
SC113406 | NOP10 (untagged)-Human NOP10 ribonucleoprotein homolog (yeast) (NOP10) |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review