CPEB1 (NM_030594) Human Tagged ORF Clone

CAT#: RC208662

CPEB1 (Myc-DDK-tagged)-Human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 2 publications.

Product images

Specifications

Product Data
Product Name CPEB1 (NM_030594) Human Tagged ORF Clone
Symbol CPEB1
Synonyms CPE-BP1; CPEB; CPEB-1; h-CPEB; hCPEB-1
Vector pCMV6-Entry
Sequence Data
>RC208662 representing NM_030594
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTTCCCGCTGGAAGAAGAAGCAGGAAGGATAAAAGATTGCTGGGACAACCAGGAAGCACCTGCTC
TCTCCACGTGTAGTAATGCCAATATCTTTCGAAGGATAAATGCCATATTGGATAATTCTCTGGATTTCAG
TAGAGTCTGCACTACACCTATAAACCGAGGAATTCATGATCATTTGCCAGACTTCCAGGACTCTGAAGAA
ACAGTTACAAGCAGGATGCTTTTCCCAACCTCTGCGCAAGAATCTTCCCGTGGCCTCCCAGATGCAAATG
ACTTGTGCCTTGGCCTGCAGTCCCTCAGTCTGACAGGCTGGGACCGACCCTGGAGCACCCAGGACTCAGA
TTCCTCAGCCCAGAGCAGCACACACTCGGTACTGAGCATGCTCCATAACCCACTGGGAAATGTCCTAGGA
AAACCCCCCTTGAGCTTCCTGCCTCTGGATCCCCTTGGGTCTGACTTGGTGGACAAGTTTCCAGCACCCT
CAGTTAGAGGATCACGCCTGGACACCCGGCCCATCCTGGACTCTCGATCTAGCAGCCCCTCTGACTCAGA
CACCAGTGGCTTCAGCTCTGGATCAGATCATCTCTCAGATTTGATTTCAAGCCTTCGCATTTCTCCACCT
CTGCCCTTCCTGTCTCTGTCAGGGGGTGGTCCCAGAGACCCTTTAAAGATGGGGGTAGGGTCTCGGATGG
ACCAAGAGCAAGCTGCTCTTGCTGCAGTCACTCCCTCCCCAACCAGTGCTTCAAAGAGATGGCCAGGAGC
TTCTGTGTGGCCATCCTGGGACCTCCTCGAAGCTCCCAAAGACCCCTTCAGCATAGAGAGAGAGGCCAGG
CTGCACCGACAAGCTGCAGCTGTGAATGAAGCCACCTGTACCTGGAGTGGCCAGCTTCCTCCCCGGAACT
ATAAGAACCCCATCTACTCTTGCAAGGTGTTTCTAGGAGGTGTTCCTTGGGATATTACAGAAGCTGGATT
AGTTAACACCTTCCGTGTTTTTGGCTCTTTGAGTGTGGAGTGGCCTGGTAAGGATGGCAAGCATCCCCGG
TGTCCTCCCAAAGGGTATGTGTATCTGGTCTTCGAACTAGAGAAGTCTGTCCGATCCTTGCTTCAGGCTT
GCTCTCATGACCCGCTGAGCCCAGATGGCCTGAGTGAATATTATTTCAAGATGTCCAGCCGAAGGATGCG
CTGCAAGGAGGTGCAGGTGATCCCCTGGGTATTAGCCGACAGTAACTTTGTCCGGAGCCCATCTCAGAGG
CTTGACCCCAGCAGGACGGTGTTTGTCGGTGCTCTGCATGGAATGCTAAATGCTGAGGCCCTGGCAGCCA
TCTTGAACGACCTATTTGGTGGAGTGGTGTATGCCGGGATTGACACAGATAAGCACAAGTATCCCATTGG
TTCTGGTCGTGTGACTTTCAATAACCAACGGAGTTACCTGAAAGCAGTCAGCGCTGCTTTTGTGGAGATC
AAAACCACCAAGTTCACAAAGAAGGTTCAGATTGACCCCTACCTAGAAGATTCTCTGTGTCATATCTGCA
GTTCTCAGCCTGGTCCTTTCTTCTGTCGAGATCAGGTCTGCTTCAAATACTTCTGCCGGAGCTGCTGGCA
CTGGCGGCACAGCATGGAGGGCCTGCGCCACCACAGCCCCCTGATGCGGAACCAGAAGAACCGAGATTCC
AGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208662 representing NM_030594
Red=Cloning site Green=Tags(s)

MAFPLEEEAGRIKDCWDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHDHLPDFQDSEE
TVTSRMLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSAQSSTHSVLSMLHNPLGNVLG
KPPLSFLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRSSSPSDSDTSGFSSGSDHLSDLISSLRISPP
LPFLSLSGGGPRDPLKMGVGSRMDQEQAALAAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREAR
LHRQAAAVNEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPR
CPPKGYVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQR
LDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEI
KTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQKNRDS
S

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_030594
ORF Size 1683 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_030594.3, NM_030594.4, NP_085097
RefSeq Size 3202
RefSeq ORF 1686
Locus ID 64506
Cytogenetics 15q25.2
Protein Pathways Oocyte meiosis, Dorso-ventral axis formation, Progesterone-mediated oocyte maturation
MW 61.9 kDa
Gene Summary This gene encodes a member of the cytoplasmic polyadenylation element binding protein family. This highly conserved protein binds to a specific RNA sequence, called the cytoplasmic polyadenylation element, found in the 3' untranslated region of some mRNAs. The encoded protein functions in both the cytoplasm and the nucleus. It is involved in the regulation of mRNA translation, as well as processing of the 3' untranslated region, and may play a role in cell proliferation and tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)