CD56 (NCAM1) (NM_181351) Human Tagged ORF Clone

CAT#: RC207890

Reviews ()
Write a review

NCAM1 (Myc-DDK-tagged)-Human neural cell adhesion molecule 1 (NCAM1), transcript variant 2



  "NM_181351" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NCAM1
Synonyms CD56; MSK39; NCAM
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207890 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCAAACTAAGGATCTCATCTGGACTTTGTTTTTCCTGGGAACTGCAGTTTCTCTGCAGGTGGATA
TTGTTCCCAGCCAGGGGGAGATCAGCGTTGGAGAGTCCAAATTCTTCTTATGCCAAGTGGCAGGAGATGC
CAAAGATAAAGACATCTCCTGGTTCTCCCCCAATGGAGAAAAGCTCACCCCAAACCAGCAGCGGATCTCA
GTGGTGTGGAATGATGATTCCTCCTCCACCCTCACCATCTATAACGCCAACATCGACGACGCCGGCATTT
ACAAGTGTGTGGTTACAGGCGAGGATGGCAGTGAGTCAGAGGCCACCGTCAACGTGAAGATCTTTCAGAA
GCTCATGTTCAAGAATGCGCCAACCCCACAGGAGTTCCGGGAGGGGGAAGATGCCGTGATTGTGTGTGAT
GTGGTCAGCTCCCTCCCACCAACCATCATCTGGAAACACAAAGGCCGAGATGTCATCCTGAAAAAAGATG
TCCGATTCATAGTCCTGTCCAACAACTACCTGCAGATCCGGGGCATCAAGAAAACAGATGAGGGCACTTA
TCGCTGTGAGGGCAGAATCCTGGCACGGGGGGAGATCAACTTCAAGGACATTCAGGTCATTGTGAATGTG
CCACCTACCATCCAGGCCAGGCAGAATATTGTGAATGCCACCGCCAACCTCGGCCAGTCCGTCACCCTGG
TGTGCGATGCCGAAGGCTTCCCAGAGCCCACCATGAGCTGGACAAAGGATGGGGAACAGATAGAGCAAGA
GGAAGACGATGAGAAGTACATCTTCAGCGACGATAGTTCCCAGCTGACCATCAAAAAGGTGGATAAGAAC
GACGAGGCTGAGTACATCTGCATTGCTGAGAACAAGGCTGGCGAGCAGGATGCGACCATCCACCTCAAAG
TCTTTGCAAAACCCAAAATCACATATGTAGAGAACCAGACTGCCATGGAATTAGAGGAGCAGGTCACTCT
TACCTGTGAAGCCTCCGGAGACCCCATTCCCTCCATCACCTGGAGGACTTCTACCCGGAACATCAGCAGC
GAAGAAAAGGCTTCGTGGACTCGACCAGAGAAGCAAGAGACTCTGGATGGGCACATGGTGGTGCGTAGCC
ATGCCCGTGTGTCGTCGCTGACCCTGAAGAGCATCCAGTACACTGATGCCGGAGAGTACATCTGCACCGC
CAGCAACACCATCGGCCAGGACTCCCAGTCCATGTACCTTGAAGTGCAATATGCCCCAAAGCTACAGGGC
CCTGTGGCTGTGTACACTTGGGAGGGGAACCAGGTGAACATCACCTGCGAGGTATTTGCCTATCCCAGTG
CCACGATCTCATGGTTTCGGGATGGCCAGCTGCTGCCAAGCTCCAATTACAGCAATATCAAGATCTACAA
CACCCCCTCTGCCAGCTATCTGGAGGTGACCCCAGACTCTGAGAATGATTTTGGGAACTACAACTGTACT
GCAGTGAACCGCATTGGGCAGGAGTCCTTGGAATTCATCCTTGTTCAAGCAGACACCCCCTCTTCACCAT
CCATCGACCAGGTGGAGCCATACTCCAGCACAGCCCAGGTGCAGTTTGATGAACCAGAGGCCACAGGTGG
GGTGCCCATCCTCAAATACAAAGCTGAGTGGAGAGCAGTGGGTGAAGAAGTATGGCATTCCAAGTGGTAT
GATGCCAAGGAAGCCAGCATGGAGGGCATCGTCACCATCGTGGGCCTGAAGCCCGAAACAACGTACGCCG
TAAGGCTGGCGGCGCTCAATGGCAAAGGGCTGGGTGAGATCAGCGCGGCCTCCGAGTTCAAGACGCAGCC
AGTCCAAGGGGAACCCAGTGCACCTAAGCTCGAAGGGCAGATGGGAGAGGATGGAAACTCTATTAAAGTG
AACCTGATCAAGCAGGATGACGGCGGCTCCCCCATCAGACACTATCTGGTCAGGTACCGAGCGCTCTCCT
CCGAGTGGAAACCAGAGATCAGGCTCCCGTCTGGCAGTGACCACGTCATGCTGAAGTCCCTGGACTGGAA
TGCTGAGTATGAGGTCTACGTGGTGGCTGAGAACCAGCAAGGAAAATCCAAGGCGGCTCATTTTGTGTTC
AGGACCTCGGCCCAGCCCACAGCCATCCCAGCCAACGGCAGCCCCACCTCAGGCCTGAGCACCGGGGCCA
TCGTGGGCATCCTCATCGTCATCTTCGTCCTGCTCCTGGTGGTTGTGGACATCACCTGCTACTTCCTGAA
CAAGTGTGGCCTGTTCATGTGCATTGCGGTCAACCTGTGTGGAAAAGCCGGGCCCGGGGCCAAGGGCAAG
GACATGGAGGAGGGCAAGGCCGCCTTCTCGAAAGATGAGTCCAAGGAGCCCATCGTGGAGGTTCGAACGG
AGGAGGAGAGGACCCCAAACCATGATGGAGGGAAACACACAGAGCCCAACGAGACCACGCCACTGACGGA
GCCCGAGAAGGGCCCCGTAGAAGCAAAGCCAGAGTGCCAGGAGACAGAAACGAAGCCAGCGCCAGCCGAA
GTCAAGACGGTCCCCAATGACGCCACACAGACAAAGGAGAACGAGAACAAAGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207890 protein sequence
Red=Cloning site Green=Tags(s)

MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRIS
VVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCD
VVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNV
PPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKN
DEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISS
EEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQG
PVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCT
AVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWY
DAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVQGEPSAPKLEGQMGEDGNSIKV
NLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVF
RTSAQPTAIPANGSPTSGLSTGAIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGK
DMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAE
VKTVPNDATQTKENENKA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_181351
ORF Size 2574 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_181351.1, NP_851996.1
RefSeq Size 6007 bp
RefSeq ORF 2577 bp
Locus ID 4684
UniProt ID P13591
Cytogenetics 11q23.2
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Prion diseases
MW 94.6 kDa
Gene Summary This gene encodes a cell adhesion protein which is a member of the immunoglobulin superfamily. The encoded protein is involved in cell-to-cell interactions as well as cell-matrix interactions during development and differentiation. The encoded protein plays a role in the development of the nervous system by regulating neurogenesis, neurite outgrowth, and cell migration. This protein is also involved in the expansion of T lymphocytes, B lymphocytes and natural killer (NK) cells which play an important role in immune surveillance. This protein plays a role in signal transduction by interacting with fibroblast growth factor receptors, N-cadherin and other components of the extracellular matrix and by triggering signalling cascades involving FYN-focal adhesion kinase (FAK), mitogen-activated protein kinase (MAPK), and phosphatidylinositol 3-kinase (PI3K). One prominent isoform of this gene, cell surface molecule CD56, plays a role in several myeloproliferative disorders such as acute myeloid leukemia and differential expression of this gene is associated with differential disease progression. For example, increased expression of CD56 is correlated with lower survival in acute myeloid leukemia patients whereas increased severity of COVID-19 is correlated with decreased abundance of CD56-expressing NK cells in peripheral blood. Alternative splicing results in multiple transcript variants encoding distinct protein isoforms. [provided by RefSeq, Aug 2020]

Other Versions

Other products for "NCAM1"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.