TRIM22 (NM_006074) Human Tagged ORF Clone

CAT#: RC207431

TRIM22 (Myc-DDK-tagged)-Human tripartite motif containing 22 (TRIM22), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name TRIM22 (NM_006074) Human Tagged ORF Clone
Symbol TRIM22
Synonyms GPSTAF50; RNF94; STAF50
Vector pCMV6-Entry
Sequence Data
>RC207431 representing NM_006074
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTTCTCAGTAAAGGTAGACATAGAGAAGGAGGTGACCTGCCCCATCTGCCTGGAGCTCCTGACAG
AACCTCTGAGCCTAGATTGTGGCCACAGCTTCTGCCAAGCCTGCATCACTGCAAAGATCAAGGAGTCAGT
GATCATCTCAAGAGGGGAAAGCAGCTGTCCTGTGTGTCAGACCAGATTCCAGCCTGGGAACCTCCGACCT
AATCGGCATCTGGCCAACATAGTTGAGAGAGTCAAAGAGGTCAAGATGAGCCCACAGGAGGGGCAGAAGA
GAGATGTCTGTGAGCACCATGGAAAAAAACTCCAGATCTTCTGTAAGGAGGATGGAAAAGTCATTTGCTG
GGTTTGTGAACTGTCTCAGGAACACCAAGGTCACCAAACATTCCGCATAAACGAGGTGGTCAAGGAATGT
CAGGAAAAGCTGCAGGTAGCCCTGCAGAGGCTGATAAAGGAGGATCAAGAGGCTGAGAAGCTGGAAGATG
ACATCAGACAAGAGAGAACCGCCTGGAAGAATTATATCCAGATCGAGAGACAGAAGATTCTGAAAGGGTT
CAATGAAATGAGAGTCATCTTGGACAATGAGGAGCAGAGAGAGCTGCAAAAGCTGGAGGAAGGTGAGGTG
AATGTGCTGGACAACCTGGCAGCAGCTACAGACCAGCTGGTCCAGCAGAGGCAGGATGCCAGCACGCTCA
TCTCAGATCTCCAGCGGAGGTTGAGGGGATCGTCAGTAGAGATGCTGCAGGATGTGATTGACGTCATGAA
AAGGAGTGAAAGCTGGACATTGAAGAAGCCAAAATCTGTTTCCAAGAAACTAAAGAGTGTATTCCGAGTA
CCAGATCTGAGTGGGATGCTGCAAGTTCTTAAAGAGCTGACAGATGTCCAGTACTACTGGGTGGACGTGA
TGCTGAATCCAGGCAGTGCCACTTCGAATGTTGCTATTTCTGTGGATCAGAGACAAGTGAAAACTGTACG
CACCTGCACATTTAAGAATTCAAATCCATGTGATTTTTCTGCTTTTGGTGTCTTCGGCTGCCAATATTTC
TCTTCGGGGAAATATTACTGGGAAGTAGATGTGTCTGGAAAGATTGCCTGGATCCTGGGCGTACACAGTA
AAATAAGTAGTCTGAATAAAAGGAAGAGCTCTGGGTTTGCTTTTGATCCAAGTGTAAATTATTCAAAAGT
TTACTCCAGATATAGACCTCAATATGGCTACTGGGTTATAGGATTACAGAATACATGTGAATATAATGCT
TTTGAGGACTCCTCCTCTTCTGATCCCAAGGTTTTGACTCTCTTTATGGCTGTGCCTCCCTGTCGTATTG
GGGTTTTCCTAGACTATGAGGCAGGCATTGTCTCATTTTTCAATGTCACAAACCACGGAGCACTCATCTA
CAAGTTCTCTGGATGTCGCTTTTCTCGACCTGCTTATCCGTATTTCAATCCTTGGAACTGCCTAGTCCCC
ATGACTGTGTGCCCACCGAGCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207431 representing NM_006074
Red=Cloning site Green=Tags(s)

MDFSVKVDIEKEVTCPICLELLTEPLSLDCGHSFCQACITAKIKESVIISRGESSCPVCQTRFQPGNLRP
NRHLANIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCELSQEHQGHQTFRINEVVKEC
QEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEV
NVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV
PDLSGMLQVLKELTDVQYYWVDVMLNPGSATSNVAISVDQRQVKTVRTCTFKNSNPCDFSAFGVFGCQYF
SSGKYYWEVDVSGKIAWILGVHSKISSLNKRKSSGFAFDPSVNYSKVYSRYRPQYGYWVIGLQNTCEYNA
FEDSSSSDPKVLTLFMAVPPCRIGVFLDYEAGIVSFFNVTNHGALIYKFSGCRFSRPAYPYFNPWNCLVP
MTVCPPSS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006074
ORF Size 1494 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006074.3, NM_006074.4, NP_006065
RefSeq Size 3015
RefSeq ORF 1497
Locus ID 10346
Cytogenetics 11p15.4
Domains BBOX, RING
Protein Families Transcription Factors, Druggable Genome
MW 56.8 kDa
Gene Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the cytoplasm and its expression is induced by interferon. The protein down-regulates transcription from the HIV-1 LTR promoter region, suggesting that function of this protein may be to mediate interferon's antiviral effects. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)