TRIM22 (NM_006074) Human Tagged ORF Clone

CAT#: RC207431

Reviews ()
Write a review

TRIM22 (Myc-DDK-tagged)-Human tripartite motif containing 22 (TRIM22), transcript variant 1



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "TRIM22"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TRIM22
Synonyms GPSTAF50; RNF94; STAF50
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207431 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTTCTCAGTAAAGGTAGACATAGAGAAGGAGGTGACCTGCCCCATCTGCCTGGAGCTCCTGACAG
AACCTCTGAGCCTAGATTGTGGCCACAGCTTCTGCCAAGCCTGCATCACTGCAAAGATCAAGGAGTCAGT
GATCATCTCAAGAGGGGAAAGCAGCTGTCCTGTGTGTCAGACCAGATTCCAGCCTGGGAACCTCCGACCT
AATCGGCATCTGGCCAACATAGTTGAGAGAGTCAAAGAGGTCAAGATGAGCCCACAGGAGGGGCAGAAGA
GAGATGTCTGTGAGCACCATGGAAAAAAACTCCAGATCTTCTGTAAGGAGGATGGAAAAGTCATTTGCTG
GGTTTGTGAACTGTCTCAGGAACACCAAGGTCACCAAACATTCCGCATAAACGAGGTGGTCAAGGAATGT
CAGGAAAAGCTGCAGGTAGCCCTGCAGAGGCTGATAAAGGAGGATCAAGAGGCTGAGAAGCTGGAAGATG
ACATCAGACAAGAGAGAACCGCCTGGAAGAATTATATCCAGATCGAGAGACAGAAGATTCTGAAAGGGTT
CAATGAAATGAGAGTCATCTTGGACAATGAGGAGCAGAGAGAGCTGCAAAAGCTGGAGGAAGGTGAGGTG
AATGTGCTGGACAACCTGGCAGCAGCTACAGACCAGCTGGTCCAGCAGAGGCAGGATGCCAGCACGCTCA
TCTCAGATCTCCAGCGGAGGTTGAGGGGATCGTCAGTAGAGATGCTGCAGGATGTGATTGACGTCATGAA
AAGGAGTGAAAGCTGGACATTGAAGAAGCCAAAATCTGTTTCCAAGAAACTAAAGAGTGTATTCCGAGTA
CCAGATCTGAGTGGGATGCTGCAAGTTCTTAAAGAGCTGACAGATGTCCAGTACTACTGGGTGGACGTGA
TGCTGAATCCAGGCAGTGCCACTTCGAATGTTGCTATTTCTGTGGATCAGAGACAAGTGAAAACTGTACG
CACCTGCACATTTAAGAATTCAAATCCATGTGATTTTTCTGCTTTTGGTGTCTTCGGCTGCCAATATTTC
TCTTCGGGGAAATATTACTGGGAAGTAGATGTGTCTGGAAAGATTGCCTGGATCCTGGGCGTACACAGTA
AAATAAGTAGTCTGAATAAAAGGAAGAGCTCTGGGTTTGCTTTTGATCCAAGTGTAAATTATTCAAAAGT
TTACTCCAGATATAGACCTCAATATGGCTACTGGGTTATAGGATTACAGAATACATGTGAATATAATGCT
TTTGAGGACTCCTCCTCTTCTGATCCCAAGGTTTTGACTCTCTTTATGGCTGTGCCTCCCTGTCGTATTG
GGGTTTTCCTAGACTATGAGGCAGGCATTGTCTCATTTTTCAATGTCACAAACCACGGAGCACTCATCTA
CAAGTTCTCTGGATGTCGCTTTTCTCGACCTGCTTATCCGTATTTCAATCCTTGGAACTGCCTAGTCCCC
ATGACTGTGTGCCCACCGAGCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207431 protein sequence
Red=Cloning site Green=Tags(s)

MDFSVKVDIEKEVTCPICLELLTEPLSLDCGHSFCQACITAKIKESVIISRGESSCPVCQTRFQPGNLRP
NRHLANIVERVKEVKMSPQEGQKRDVCEHHGKKLQIFCKEDGKVICWVCELSQEHQGHQTFRINEVVKEC
QEKLQVALQRLIKEDQEAEKLEDDIRQERTAWKNYIQIERQKILKGFNEMRVILDNEEQRELQKLEEGEV
NVLDNLAAATDQLVQQRQDASTLISDLQRRLRGSSVEMLQDVIDVMKRSESWTLKKPKSVSKKLKSVFRV
PDLSGMLQVLKELTDVQYYWVDVMLNPGSATSNVAISVDQRQVKTVRTCTFKNSNPCDFSAFGVFGCQYF
SSGKYYWEVDVSGKIAWILGVHSKISSLNKRKSSGFAFDPSVNYSKVYSRYRPQYGYWVIGLQNTCEYNA
FEDSSSSDPKVLTLFMAVPPCRIGVFLDYEAGIVSFFNVTNHGALIYKFSGCRFSRPAYPYFNPWNCLVP
MTVCPPSS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006074
ORF Size 1494 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006074.5
RefSeq Size 3111 bp
RefSeq ORF 1497 bp
Locus ID 10346
UniProt ID Q8IYM9
Cytogenetics 11p15.4
Domains zf-B_box, RING
Protein Families Druggable Genome, Transcription Factors
MW 56.9 kDa
Gene Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the cytoplasm and its expression is induced by interferon. The protein down-regulates transcription from the HIV-1 LTR promoter region, suggesting that function of this protein may be to mediate interferon's antiviral effects. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.