GALNT4 (NM_003774) Human Tagged ORF Clone

CAT#: RC207176

GALNT4 (Myc-DDK-tagged)-Human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 4 (GalNAc-T4) (GALNT4)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GALNT4 (NM_003774) Human Tagged ORF Clone
Symbol GALNT4
Synonyms GALNAC-T4; GALNACT4
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC207176 representing NM_003774
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTGAGGTGGACTTGGGCAGGCAAGAGCTGCCTGCTGCTGGCGTTTTTAACAGTGGCCTATATCT
TCGTGGAGCTCTTGGTCTCTACTTTTCATGCCTCCGCAGGAGCCGGCCGTGCCAGGGAGCTGGGGTCAAG
AAGGCTCTCAGGCCTCCAGAAAAATACGGAGGATTTGTCTCGACCGCTTTATAAGAAGCCCCCTGCAGAT
TCCCGTGCACTTGGGGAGTGGGGGAAAGCCAGCAAACTCCAGCTCAACGAGGATGAACTGAAGCAGCAAG
AAGAACTCATTGAGAGATACGCCATCAATATTTACCTCAGTGACAGGATTTCCCTGCATCGACACATAGA
GGATAAAAGAATGTATGAGTGTAAGTCCCAGAAGTTCAACTATAGGACACTTCCTACCACCTCTGTTATC
ATTGCTTTCTATAACGAAGCCTGGTCGACTTTGCTCCGTACCATTCACAGTGTTTTAGAAACTTCTCCTG
CAGTTCTTTTGAAAGAGATCATCTTGGTGGATGACTTGAGTGACAGAGTTTATTTGAAGACACAACTTGA
AACTTACATCAGCAATCTTGATAGAGTACGCTTGATTAGGACCAATAAGCGAGAGGGGCTGGTTAGGGCC
CGTCTGATTGGGGCCACTTTCGCCACTGGGGACGTCCTCACTTTCCTGGATTGTCACTGTGAGTGTAATT
CCGGTTGGCTGGAACCGCTTTTGGAAAGGATTGGGAGAGATGAAACAGCAGTTGTGTGTCCTGTTATAGA
CACAATTGATTGGAATACTTTTGAATTCTATATGCAGATAGGGGAGCCCATGATTGGTGGGTTTGACTGG
CGTTTAACATTTCAGTGGCATTCTGTCCCCAAACAGGAAAGGGACAGGCGGATATCAAGAATTGACCCCA
TCAGATCACCTACCATGGCTGGAGGACTGTTTGCTGTCAGCAAGAAATATTTTCAGTACCTTGGAACGTA
TGACACAGGAATGGAAGTGTGGGGAGGTGAAAACCTTGAGCTGTCTTTTAGGGTGTGGCAGTGTGGTGGC
AAATTGGAGATCCACCCGTGTTCCCACGTGGGCCATGTGTTCCCCAAGCGGGCACCATATGCTCGCCCCA
ATTTCCTACAGAATACTGCTCGGGCAGCAGAAGTTTGGATGGATGAATACAAAGAGCACTTCTACAATAG
AAACCCTCCAGCAAGAAAAGAAGCTTATGGTGATATTTCTGAAAGAAAATTACTACGAGAGCGGTTGAGA
TGCAAGAGCTTTGACTGGTATTTGAAAAACGTTTTTCCTAATTTACATGTTCCAGAGGATAGACCAGGCT
GGCATGGGGCTATTCGCAGTAGAGGGATCTCGTCTGAATGTTTAGATTATAATTCTCCTGACAACAACCC
CACAGGTGCTAACCTTTCACTGTTTGGATGCCATGGTCAAGGAGGCAATCAATTCTTTGAATATACTTCA
AACAAAGAAATAAGGTTTAATTCTGTGACAGAGTTATGTGCAGAGGTACCTGAGCAAAAAAATTATGTGG
GAATGCAAAATTGTCCCAAAGATGGGTTCCCTGTACCAGCAAACATTATTTGGCATTTTAAAGAAGATGG
AACTATTTTTCACCCACACTCAGGACTGTGTCTTAGTGCTTATCGGACACCGGAGGGCCGACCTGATGTA
CAAATGAGAACTTGTGATGCTCTAGATAAAAATCAAATTTGGAGTTTTGAGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207176 representing NM_003774
Red=Cloning site Green=Tags(s)

MAVRWTWAGKSCLLLAFLTVAYIFVELLVSTFHASAGAGRARELGSRRLSGLQKNTEDLSRPLYKKPPAD
SRALGEWGKASKLQLNEDELKQQEELIERYAINIYLSDRISLHRHIEDKRMYECKSQKFNYRTLPTTSVI
IAFYNEAWSTLLRTIHSVLETSPAVLLKEIILVDDLSDRVYLKTQLETYISNLDRVRLIRTNKREGLVRA
RLIGATFATGDVLTFLDCHCECNSGWLEPLLERIGRDETAVVCPVIDTIDWNTFEFYMQIGEPMIGGFDW
RLTFQWHSVPKQERDRRISRIDPIRSPTMAGGLFAVSKKYFQYLGTYDTGMEVWGGENLELSFRVWQCGG
KLEIHPCSHVGHVFPKRAPYARPNFLQNTARAAEVWMDEYKEHFYNRNPPARKEAYGDISERKLLRERLR
CKSFDWYLKNVFPNLHVPEDRPGWHGAIRSRGISSECLDYNSPDNNPTGANLSLFGCHGQGGNQFFEYTS
NKEIRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTIFHPHSGLCLSAYRTPEGRPDV
QMRTCDALDKNQIWSFEK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003774
ORF Size 1734 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003774.1, NM_003774.2, NM_003774.3, NM_003774.4, NP_003765
RefSeq Size 5360
RefSeq ORF 1737
Locus ID 8693
Cytogenetics 12q21.33
Domains RICIN, Glycos_transf_2
Protein Pathways O-Glycan biosynthesis, Metabolic pathways
MW 66.5 kDa
Gene Summary This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. In vitro, the encoded protein can complement other GalNAc-Ts in the complete O-glycosylation of the mucin-1 tandem repeat and can O-glycosylate the P-selectin glycoprotein ligand-1 molecule. The coding region of this gene is contained within a single exon. Fusion transcripts, which combine part of this gene with the 5' exons of the neighboring POC1B (POC1 centriolar protein homolog B) gene, also exist. [provided by RefSeq, Dec 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)