Cullin 4B(CUL4B) (NM_003588) Human Tagged ORF Clone

CAT#: RC206935

CUL4B (Myc-DDK-tagged)-Human cullin 4B (CUL4B), transcript variant 1

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cullin 4B(CUL4B) (NM_003588) Human Tagged ORF Clone
Symbol CUL4B
Synonyms CUL-4B; MRXHF2; MRXS15; MRXSC; SFM2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC206935 representing NM_003588
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGTCACAGTCATCTGGATCAGGAGATGGGAATGATGATGAGGCTACTACCTCTAAAGACGGTGGTT
TTTCTTCCCCCAGTCCCTCAGCTGCTGCTGCTGCTCAGGAGGTCAGATCTGCCACTGATGGTAATACCAG
CACCACTCCGCCCACCTCTGCCAAGAAGAGAAAGTTAAACAGCAGCAGCAGTAGCAGCAGTAACAGTAGT
AACGAGAGAGAAGACTTTGATTCCACCTCTTCCTCCTCTTCCACTCCTCCTTTACAACCCAGGGATTCGG
CATCCCCTTCAACCTCGTCCTTCTGCCTGGGGGTTTCAGTGGCTGCTTCCAGCCACGTACCGATACAGAA
GAAGCTGCGTTTTGAAGACACCCTGGAGTTTGTAGGGTTTGATGCGAAGATGGCTGAGGAATCCTCCTCC
TCCTCCTCCTCATCTTCACCAACTGCTGCAACATCTCAGCAGCAGCAACTTAAAAATAAGAGTATATTAA
TCTCTTCTGTGGCTTCGGTGCATCATGCAAACGGCCTAGCCAAATCTTCTACCACCGTCTCTAGCTTTGC
TAACAGCAAACCTGGCTCTGCTAAGAAGTTAGTGATCAAGAACTTTAAAGATAAGCCTAAATTACCAGAA
AACTACACAGATGAAACCTGGCAAAAACTGAAAGAAGCAGTGGAAGCTATTCAGAATAGTACTTCAATTA
AGTACAATTTAGAAGAACTCTACCAGGCTGTAGAAAATCTCTGTTCTTACAAGATTTCTGCAAACTTGTA
CAAACAGCTGAGACAGATCTGCGAAGATCACATCAAAGCACAGATTCATCAATTCAGAGAGGATTCATTG
GATAGCGTTCTTTTTTTAAAGAAGATTGATAGATGCTGGCAAAACCATTGCAGACAAATGATCATGATCA
GGAGCATTTTTTTGTTTCTGGATAGAACTTACGTTCTTCAGAATTCAATGCTACCCTCCATTTGGGACAT
GGGACTGGAGTTATTTAGGGCTCATATTATAAGTGATCAGAAAGTGCAGAATAAGACAATTGATGGCATT
CTTCTCTTGATTGAGAGGGAAAGGAATGGTGAAGCAATTGATAGAAGTTTACTTCGAAGCCTTTTAAGCA
TGCTGTCTGATTTGCAAATTTATCAAGATTCTTTTGAACAACGATTTTTGGAAGAAACTAACCGGCTCTA
TGCAGCTGAAGGCCAAAAATTAATGCAAGAAAGAGAGGTTCCTGAATATCTACATCATGTTAACAAACGT
CTAGAAGAAGAAGCAGACAGACTTATTACTTACTTAGATCAGACCACCCAGAAGTCATTAATTGCTACTG
TAGAAAAACAACTTCTAGGTGAACACTTAACAGCAATTCTTCAGAAAGGTTTAAATAACCTCCTTGATGA
AAACCGAATTCAAGATTTGTCTCTTCTGTATCAGCTCTTCAGTAGAGTTCGAGGTGGAGTTCAGGTTCTT
TTGCAGCAGTGGATCGAATATATCAAGGCATTTGGCAGCACTATTGTAATTAATCCTGAAAAAGATAAAA
CCATGGTTCAAGAATTGCTGGATTTTAAAGATAAGGTTGACCATATAATTGATATCTGCTTTCTGAAGAA
TGAGAAATTTATCAATGCCATGAAAGAAGCATTTGAAACGTTCATTAACAAAAGACCAAATAAACCAGCT
GAACTTATAGCTAAGTATGTAGATTCAAAACTTCGTGCAGGCAACAAAGAAGCTACAGATGAAGAACTTG
AGAAAATGTTGGATAAAATTATGATCATATTTAGATTTATCTATGGCAAGGATGTTTTTGAGGCCTTCTA
TAAGAAAGATTTAGCCAAGCGCCTGTTAGTCGGAAAGAGTGCATCTGTAGATGCTGAAAAATCAATGCTG
TCCAAACTTAAACATGAATGCGGAGCTGCTTTCACCAGCAAACTTGAAGGAATGTTTAAAGACATGGAAC
TTTCTAAAGACATCATGATTCAGTTCAAACAGTATATGCAGAATCAGAATGTTCCGGGAAATATTGAGTT
AACTGTGAATATCCTGACAATGGGCTATTGGCCGACATATGTGCCTATGGAAGTTCATTTACCACCAGAG
ATGGTAAAACTTCAGGAGATTTTCAAGACATTTTACCTAGGCAAACATAGTGGCAGGAAACTTCAGTGGC
AGTCAACCATAGGACACTGTGTGTTAAAAGCAGAATTTAAAGAGGGTAAAAAGGAACTCCAGGTCTCTCT
TTTTCAAACACTGGTGCTGCTAATGTTTAATGAGGGAGAGGAGTTCAGTTTAGAAGAGATCAAGCAGGCA
ACTGGAATAGAGGATGGAGAGTTAAGGAGAACACTGCAGTCATTAGCCTGTGGCAAAGCTAGAGTTCTGG
CGAAAAATCCAAAGGGCAAAGACATTGAAGATGGTGACAAGTTCATTTGTAATGATGATTTCAAACATAA
ACTTTTCAGGATAAAGATCAATCAAATCCAGATGAAAGAAACGGTTGAAGAACAAGCAAGCACTACAGAA
AGAGTATTTCAAGACAGACAGTATCAAATTGATGCTGCAATTGTTCGAATTATGAAGATGAGAAAGACAC
TTAGCCACAATCTCCTTGTTTCAGAAGTGTACAACCAGTTGAAATTTCCAGTAAAGCCTGCTGATCTTAA
GAAGAGAATAGAATCTTTAATTGACCGGGACTACATGGAAAGAGATAAAGAAAATCCAAACCAGTACAAC
TATATTGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206935 representing NM_003588
Red=Cloning site Green=Tags(s)

MMSQSSGSGDGNDDEATTSKDGGFSSPSPSAAAAAQEVRSATDGNTSTTPPTSAKKRKLNSSSSSSSNSS
NEREDFDSTSSSSSTPPLQPRDSASPSTSSFCLGVSVAASSHVPIQKKLRFEDTLEFVGFDAKMAEESSS
SSSSSSPTAATSQQQQLKNKSILISSVASVHHANGLAKSSTTVSSFANSKPGSAKKLVIKNFKDKPKLPE
NYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSL
DSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQNKTIDGI
LLLIERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEQRFLEETNRLYAAEGQKLMQEREVPEYLHHVNKR
LEEEADRLITYLDQTTQKSLIATVEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLFSRVRGGVQVL
LQQWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDICFLKNEKFINAMKEAFETFINKRPNKPA
ELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSML
SKLKHECGAAFTSKLEGMFKDMELSKDIMIQFKQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPE
MVKLQEIFKTFYLGKHSGRKLQWQSTIGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQA
TGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE
RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYN
YIA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003588
ORF Size 2739 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003588.2, NM_003588.3, NP_003579
RefSeq Size 3278
RefSeq ORF 2742
Locus ID 8450
Cytogenetics Xq24
Domains Cullin
Protein Pathways Nucleotide excision repair, Ubiquitin mediated proteolysis
MW 103.8 kDa
Gene Summary This gene is a member of the cullin family. The encoded protein forms a complex that functions as an E3 ubiquitin ligase and catalyzes the polyubiquitination of specific protein substrates in the cell. The protein interacts with a ring finger protein, and is required for the proteolysis of several regulators of DNA replication including chromatin licensing and DNA replication factor 1 and cyclin E. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations