Cullin 4B (CUL4B) (NM_003588) Human Tagged ORF Clone

CAT#: RC206935

Reviews ()
Write a review

CUL4B (Myc-DDK-tagged)-Human cullin 4B (CUL4B), transcript variant 1



  "NM_003588" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 836.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "CUL4B"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CUL4B
Synonyms CUL-4B; MRXHF2; MRXS15; MRXSC; SFM2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206935 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGTCACAGTCATCTGGATCAGGAGATGGGAATGATGATGAGGCTACTACCTCTAAAGACGGTGGTT
TTTCTTCCCCCAGTCCCTCAGCTGCTGCTGCTGCTCAGGAGGTCAGATCTGCCACTGATGGTAATACCAG
CACCACTCCGCCCACCTCTGCCAAGAAGAGAAAGTTAAACAGCAGCAGCAGTAGCAGCAGTAACAGTAGT
AACGAGAGAGAAGACTTTGATTCCACCTCTTCCTCCTCTTCCACTCCTCCTTTACAACCCAGGGATTCGG
CATCCCCTTCAACCTCGTCCTTCTGCCTGGGGGTTTCAGTGGCTGCTTCCAGCCACGTACCGATACAGAA
GAAGCTGCGTTTTGAAGACACCCTGGAGTTTGTAGGGTTTGATGCGAAGATGGCTGAGGAATCCTCCTCC
TCCTCCTCCTCATCTTCACCAACTGCTGCAACATCTCAGCAGCAGCAACTTAAAAATAAGAGTATATTAA
TCTCTTCTGTGGCTTCGGTGCATCATGCAAACGGCCTAGCCAAATCTTCTACCACCGTCTCTAGCTTTGC
TAACAGCAAACCTGGCTCTGCTAAGAAGTTAGTGATCAAGAACTTTAAAGATAAGCCTAAATTACCAGAA
AACTACACAGATGAAACCTGGCAAAAACTGAAAGAAGCAGTGGAAGCTATTCAGAATAGTACTTCAATTA
AGTACAATTTAGAAGAACTCTACCAGGCTGTAGAAAATCTCTGTTCTTACAAGATTTCTGCAAACTTGTA
CAAACAGCTGAGACAGATCTGCGAAGATCACATCAAAGCACAGATTCATCAATTCAGAGAGGATTCATTG
GATAGCGTTCTTTTTTTAAAGAAGATTGATAGATGCTGGCAAAACCATTGCAGACAAATGATCATGATCA
GGAGCATTTTTTTGTTTCTGGATAGAACTTACGTTCTTCAGAATTCAATGCTACCCTCCATTTGGGACAT
GGGACTGGAGTTATTTAGGGCTCATATTATAAGTGATCAGAAAGTGCAGAATAAGACAATTGATGGCATT
CTTCTCTTGATTGAGAGGGAAAGGAATGGTGAAGCAATTGATAGAAGTTTACTTCGAAGCCTTTTAAGCA
TGCTGTCTGATTTGCAAATTTATCAAGATTCTTTTGAACAACGATTTTTGGAAGAAACTAACCGGCTCTA
TGCAGCTGAAGGCCAAAAATTAATGCAAGAAAGAGAGGTTCCTGAATATCTACATCATGTTAACAAACGT
CTAGAAGAAGAAGCAGACAGACTTATTACTTACTTAGATCAGACCACCCAGAAGTCATTAATTGCTACTG
TAGAAAAACAACTTCTAGGTGAACACTTAACAGCAATTCTTCAGAAAGGTTTAAATAACCTCCTTGATGA
AAACCGAATTCAAGATTTGTCTCTTCTGTATCAGCTCTTCAGTAGAGTTCGAGGTGGAGTTCAGGTTCTT
TTGCAGCAGTGGATCGAATATATCAAGGCATTTGGCAGCACTATTGTAATTAATCCTGAAAAAGATAAAA
CCATGGTTCAAGAATTGCTGGATTTTAAAGATAAGGTTGACCATATAATTGATATCTGCTTTCTGAAGAA
TGAGAAATTTATCAATGCCATGAAAGAAGCATTTGAAACGTTCATTAACAAAAGACCAAATAAACCAGCT
GAACTTATAGCTAAGTATGTAGATTCAAAACTTCGTGCAGGCAACAAAGAAGCTACAGATGAAGAACTTG
AGAAAATGTTGGATAAAATTATGATCATATTTAGATTTATCTATGGCAAGGATGTTTTTGAGGCCTTCTA
TAAGAAAGATTTAGCCAAGCGCCTGTTAGTCGGAAAGAGTGCATCTGTAGATGCTGAAAAATCAATGCTG
TCCAAACTTAAACATGAATGCGGAGCTGCTTTCACCAGCAAACTTGAAGGAATGTTTAAAGACATGGAAC
TTTCTAAAGACATCATGATTCAGTTCAAACAGTATATGCAGAATCAGAATGTTCCGGGAAATATTGAGTT
AACTGTGAATATCCTGACAATGGGCTATTGGCCGACATATGTGCCTATGGAAGTTCATTTACCACCAGAG
ATGGTAAAACTTCAGGAGATTTTCAAGACATTTTACCTAGGCAAACATAGTGGCAGGAAACTTCAGTGGC
AGTCAACCATAGGACACTGTGTGTTAAAAGCAGAATTTAAAGAGGGTAAAAAGGAACTCCAGGTCTCTCT
TTTTCAAACACTGGTGCTGCTAATGTTTAATGAGGGAGAGGAGTTCAGTTTAGAAGAGATCAAGCAGGCA
ACTGGAATAGAGGATGGAGAGTTAAGGAGAACACTGCAGTCATTAGCCTGTGGCAAAGCTAGAGTTCTGG
CGAAAAATCCAAAGGGCAAAGACATTGAAGATGGTGACAAGTTCATTTGTAATGATGATTTCAAACATAA
ACTTTTCAGGATAAAGATCAATCAAATCCAGATGAAAGAAACGGTTGAAGAACAAGCAAGCACTACAGAA
AGAGTATTTCAAGACAGACAGTATCAAATTGATGCTGCAATTGTTCGAATTATGAAGATGAGAAAGACAC
TTAGCCACAATCTCCTTGTTTCAGAAGTGTACAACCAGTTGAAATTTCCAGTAAAGCCTGCTGATCTTAA
GAAGAGAATAGAATCTTTAATTGACCGGGACTACATGGAAAGAGATAAAGAAAATCCAAACCAGTACAAC
TATATTGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206935 protein sequence
Red=Cloning site Green=Tags(s)

MMSQSSGSGDGNDDEATTSKDGGFSSPSPSAAAAAQEVRSATDGNTSTTPPTSAKKRKLNSSSSSSSNSS
NEREDFDSTSSSSSTPPLQPRDSASPSTSSFCLGVSVAASSHVPIQKKLRFEDTLEFVGFDAKMAEESSS
SSSSSSPTAATSQQQQLKNKSILISSVASVHHANGLAKSSTTVSSFANSKPGSAKKLVIKNFKDKPKLPE
NYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSL
DSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQNKTIDGI
LLLIERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEQRFLEETNRLYAAEGQKLMQEREVPEYLHHVNKR
LEEEADRLITYLDQTTQKSLIATVEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLFSRVRGGVQVL
LQQWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDICFLKNEKFINAMKEAFETFINKRPNKPA
ELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSML
SKLKHECGAAFTSKLEGMFKDMELSKDIMIQFKQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPE
MVKLQEIFKTFYLGKHSGRKLQWQSTIGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQA
TGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE
RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYN
YIA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003588
ORF Size 2739 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003588.2, NP_003579.2
RefSeq Size 5365 bp
RefSeq ORF 2742 bp
Locus ID 8450
UniProt ID Q13620
Cytogenetics Xq24
Domains CULLIN
Protein Pathways Nucleotide excision repair, Ubiquitin mediated proteolysis
MW 104 kDa
Gene Summary This gene is a member of the cullin family. The encoded protein forms a complex that functions as an E3 ubiquitin ligase and catalyzes the polyubiquitination of specific protein substrates in the cell. The protein interacts with a ring finger protein, and is required for the proteolysis of several regulators of DNA replication including chromatin licensing and DNA replication factor 1 and cyclin E. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.