CD162 (SELPLG) (NM_003006) Human Tagged ORF Clone

CAT#: RC206507

Reviews ()
Write a review

SELPLG (Myc-DDK-tagged)-Human selectin P ligand (SELPLG), transcript variant 2



  "NM_003006" in other vectors (7)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SELPLG
Synonyms CD162; CLA; PSGL-1; PSGL1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206507 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCTGCAACTCCTCCTGTTGCTGATCCTACTGGGCCCTGGCAACAGCTTGCAGCTGTGGGACACCT
GGGCAGATGAAGCCGAGAAAGCCTTGGGTCCCCTGCTTGCCCGGGACCGGAGACAGGCCACCGAATATGA
GTACCTAGATTATGATTTCCTGCCAGAAACGGAGCCTCCAGAAATGCTGAGGAACAGCACTGACACCACT
CCTCTGACTGGGCCTGGAACCCCTGAGTCTACCACTGTGGAGCCTGCTGCAAGGCGTTCTACTGGCCTGG
ATGCAGGAGGGGCAGTCACAGAGCTGACCACGGAGCTGGCCAACATGGGGAACCTGTCCACGGATTCAGC
AGCTATGGAGATACAGACCACTCAACCAGCAGCCACGGAGGCACAGACCACTCCACTGGCAGCCACAGAG
GCACAGACAACTCGACTGACGGCCACGGAGGCACAGACCACTCCACTGGCAGCCACAGAGGCACAGACCA
CTCCACCAGCAGCCACGGAAGCACAGACCACTCAACCCACAGGCCTGGAGGCACAGACCACTGCACCAGC
AGCCATGGAGGCACAGACCACTGCACCAGCAGCCATGGAAGCACAGACCACTCCACCAGCAGCCATGGAG
GCACAGACCACTCAAACCACAGCCATGGAGGCACAGACCACTGCACCAGAAGCCACGGAGGCACAGACCA
CTCAACCCACAGCCACGGAGGCACAGACCACTCCACTGGCAGCCATGGAGGCCCTGTCCACAGAACCCAG
TGCCACAGAGGCCCTGTCCATGGAACCTACTACCAAAAGAGGTCTGTTCATACCCTTTTCTGTGTCCTCT
GTTACTCACAAGGGCATTCCCATGGCAGCCAGCAATTTGTCCGTCAACTACCCAGTGGGGGCCCCAGACC
ACATCTCTGTGAAGCAGTGCCTGCTGGCCATCCTAATCTTGGCGCTGGTGGCCACTATCTTCTTCGTGTG
CACTGTGGTGCTGGCGGTCCGCCTCTCCCGCAAGGGCCACATGTACCCCGTGCGTAATTACTCCCCCACC
GAGATGGTCTGCATCTCATCCCTGTTGCCTGATGGGGGTGAGGGGCCCTCTGCCACAGCCAATGGGGGCC
TGTCCAAGGCCAAGAGCCCGGGCCTGACGCCAGAGCCCAGGGAGGACCGTGAGGGGGATGACCTCACCCT
GCACAGCTTCCTCCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206507 protein sequence
Red=Cloning site Green=Tags(s)

MPLQLLLLLILLGPGNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLRNSTDTT
PLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTPLAATE
AQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAME
AQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSS
VTHKGIPMAASNLSVNYPVGAPDHISVKQCLLAILILALVATIFFVCTVVLAVRLSRKGHMYPVRNYSPT
EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003006
ORF Size 1206 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003006.3, NP_002997.1
RefSeq Size 2573 bp
RefSeq ORF 1239 bp
Locus ID 6404
UniProt ID Q14242
Cytogenetics 12q24.11
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs)
MW 42.1 kDa
Gene Summary This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Apr 2011]

Other Versions

Other products for "SELPLG"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-SELPLG Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.