PDK1 (NM_002610) Human Tagged ORF Clone

CAT#: RC205127

Reviews ()
Write a review

PDK1 (Myc-DDK-tagged)-Human pyruvate dehydrogenase kinase, isozyme 1 (PDK1), nuclear gene encoding mitochondrial protein



Reconstitution Protocol

USD 686.00

In Stock*

Size
    • 10 ug

Product images

Other products for "PDK1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PDK1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205127 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCTGGCGCGGCTGCTTCGCGGAGCCGCCTTGGCCGGCCCGGGCCCGGGGCTGCGCGCCGCCGGCT
TCAGCCGCAGCTTCAGCTCGGACTCGGGCTCCAGCCCGGCGTCCGAGCGCGGCGTTCCGGGCCAGGTGGA
CTTCTACGCGCGCTTCTCGCCGTCCCCGCTCTCCATGAAGCAGTTCCTGGACTTCGGATCAGTGAATGCT
TGTGAAAAGACCTCATTTATGTTTCTGCGGCAAGAGTTGCCTGTCAGACTGGCAAATATAATGAAAGAAA
TAAGTCTCCTTCCAGATAATCTTCTCAGGACACCATCCGTTCAATTGGTACAAAGCTGGTATATCCAGAG
TCTTCAGGAGCTTCTTGATTTTAAGGACAAAAGTGCTGAGGATGCTAAAGCTATTTATGACTTTACAGAT
ACTGTGATACGGATCAGAAACCGACACAATGATGTCATTCCCACAATGGCCCAGGGTGTGATTGAATACA
AGGAGAGCTTTGGGGTGGATCCTGTCACCAGCCAGAATGTTCAGTACTTTTTGGATCGATTCTACATGAG
TCGCATTTCAATTAGAATGTTACTCAATCAGCACTCTTTATTGTTTGGTGGAAAAGGCAAAGGAAGTCCA
TCTCATCGAAAACACATTGGAAGCATAAATCCAAACTGCAATGTACTTGAAGTTATTAAAGATGGCTATG
AAAATGCTAGGCGTCTGTGTGATTTGTATTATATTAACTCTCCCGAACTAGAACTTGAAGAACTAAATGC
AAAATCACCAGGACAGCCAATACAAGTGGTTTATGTACCATCCCATCTCTATCACATGGTGTTTGAACTT
TTCAAGAATGCAATGAGAGCCACTATGGAACACCATGCCAACAGAGGTGTTTACCCCCCTATTCAAGTTC
ATGTCACGCTGGGTAATGAGGATTTGACTGTGAAGATGAGTGACCGAGGAGGTGGCGTTCCTTTGAGGAA
AATTGACAGACTTTTCAACTACATGTATTCAACTGCACCAAGACCTCGTGTTGAGACCTCCCGCGCAGTG
CCTCTGGCTGGTTTTGGTTATGGATTGCCCATATCACGTCTTTACGCACAATACTTCCAAGGAGACCTGA
AGCTGTATTCCCTAGAGGGTTACGGGACAGATGCAGTTATCTACATTAAGGCTCTGTCAACAGACTCAAT
AGAAAGACTCCCAGTGTATAACAAAGCTGCCTGGAAGCATTACAACACCAACCACGAGGCTGATGACTGG
TGCGTCCCCAGCAGAGAACCCAAAGACATGACGACGTTCCGCAGTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205127 protein sequence
Red=Cloning site Green=Tags(s)

MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNA
CEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTD
TVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSP
SHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFEL
FKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAV
PLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDW
CVPSREPKDMTTFRSA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002610
ORF Size 1308 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002610.5
RefSeq Size 4674 bp
RefSeq ORF 1311 bp
Locus ID 5163
UniProt ID Q15118
Cytogenetics 2q31.1
Domains HATPase_c
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Fc epsilon RI signaling pathway, Neurotrophin signaling pathway, T cell receptor signaling pathway
MW 49.2 kDa
Gene Summary Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.