HSPC014 (POMP) (NM_015932) Human Tagged ORF Clone

CAT#: RC204812

POMP (Myc-DDK-tagged)-Human proteasome maturation protein (POMP)

Product Images

Western blot validation of overexpression lysate (Cat# LY402471) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC204812 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified POMP protein (Cat# TP304812). The protein was produced from HEK293T cells transfected with POMP cDNA clone (Cat# RC204812) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: HSPC014
• Synonyms: C13orf12; HSPC014; PNAS-110; PRAAS2; UMP1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC204812 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAATGCCAGAGGACTTGGATCTGAGCTAAAGGACAGTATTCCAGTTACTGAACTTTCAGCAAGTGGAC
  CTTTTGAAAGTCATGATCTTCTTCGGAAAGGTTTTTCTTGTGTGAAAAATGAACTTTTGCCTAGTCATCC
  CCTTGAATTATCAGAAAAAAATTTCCAGCTCAACCAAGATAAAATGAATTTTTCCACACTGAGAAACATT
  CAGGGTCTATTTGCTCCGCTAAAATTACAGATGGAATTCAAGGCAGTGCAGCAGGTTCAGCGTCTTCCAT
  TTCTTTCAAGCTCAAATCTTTCACTGGATGTTTTGAGGGGTAATGATGAGACTATTGGATTTGAGGATAT
  TCTTAATGATCCATCACAAAGCGAAGTCATGGGAGAGCCACACTTGATGGTGGAATATAAACTTGGTTTA
  CTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC204812 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNI
  QGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGL
  L
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_015932
• ORF Size: 423 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_015932.6
• RefSeq Size: 1477 bp
• RefSeq ORF: 426 bp
• Locus ID: 51371
• UniProt ID: Q9Y244
• Cytogenetics: 13q12.3
• Protein Pathways: Proteasome
• MW: 15.8 kDa
• Gene Summary: The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5' UTR of this gene has been associated with KLICK syndrome, a rare skin disorder.[provided by RefSeq, Aug 2010]