SULT2A1 (NM_003167) Human Tagged ORF Clone

CAT#: RC204737

Reviews ()
Write a review

SULT2A1 (Myc-DDK-tagged)-Human sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1 (SULT2A1)



Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product images

Other products for "SULT2A1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SULT2A1
Synonyms DHEA-ST; DHEA-ST8; DHEAS; HST; hSTa; ST2; ST2A1; ST2A3; STD; SULT2A3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204737 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGACGATTTCTTATGGTTTGAAGGCATAGCTTTCCCTACTATGGGTTTCAGATCCGAAACCTTAA
GAAAAGTACGTGATGAGTTCGTGATAAGGGATGAAGATGTAATAATATTGACTTACCCCAAATCAGGAAC
AAACTGGTTGGCTGAGATTCTCTGCCTGATGCACTCCAAGGGGGATGCCAAGTGGATCCAATCTGTGCCC
ATCTGGGAGCGATCACCCTGGGTAGAGAGTGAGATTGGGTATACAGCACTCAGTGAAACGGAGAGTCCAC
GTTTATTCTCCTCCCACCTCCCCATCCAGTTATTCCCCAAGTCTTTCTTCAGTTCCAAGGCCAAGGTGAT
TTATCTCATGAGAAATCCCAGAGATGTTTTGGTGTCTGGTTATTTTTTCTGGAAAAACATGAAGTTTATT
AAGAAACCAAAGTCATGGGAAGAATATTTTGAATGGTTTTGTCAAGGAACTGTGCTATATGGGTCATGGT
TTGACCACATTCATGGCTGGATGCCCATGAGAGAGGAGAAAAACTTCCTGTTACTGAGTTATGAGGAGCT
GAAACAGGACACAGGAAGAACCATAGAGAAGATCTGTCAATTCCTGGGAAAGACGTTAGAACCCGAAGAA
CTGAACTTAATTCTCAAGAACAGCTCCTTTCAGAGCATGAAAGAAAACAAGATGTCCAATTATTCCCTCC
TGAGTGTTGATTATGTAGTGGACAAAGCACAACTTCTGAGAAAAGGTGTATCTGGGGACTGGAAAAATCA
CTTCACAGTGGCCCAAGCTGAAGACTTTGATAAATTGTTCCAAGAGAAGATGGCAGATCTTCCTCGAGAG
CTGTTCCCATGGGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204737 protein sequence
Red=Cloning site Green=Tags(s)

MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVP
IWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFI
KKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEE
LNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRE
LFPWE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003167
ORF Size 855 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003167.4
RefSeq Size 1987 bp
RefSeq ORF 858 bp
Locus ID 6822
UniProt ID Q06520
Cytogenetics 19q13.33
MW 33.8 kDa
Gene Summary This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome. [provided by RefSeq, Mar 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.