Rad6 (UBE2A) (NM_003336) Human Tagged ORF Clone

CAT#: RC204194

UBE2A (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2A (UBE2A), transcript variant 1

Product Images

Circular map for RC204194

• 

  Western blot validation of overexpression lysate (Cat# LY418754) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC204194 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified UBE2A protein (Cat# TP304194). The protein was produced from HEK293T cells transfected with UBE2A cDNA clone (Cat# RC204194) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Rad6
• Synonyms: HHR6A; MRXS30; MRXSN; RAD6A; UBC2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC204194 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCCACCCCGGCTCGGCGGCGCCTCATGCGGGACTTCAAGAGGTTGCAGGAGGATCCTCCAGCCGGAG
  TCAGCGGGGCTCCGTCCGAGAACAACATAATGGTGTGGAACGCGGTCATTTTCGGGCCTGAAGGGACCCC
  GTTTGAGGATGGAACATTTAAACTTACAATAGAATTCACTGAAGAATATCCAAATAAACCACCTACAGTT
  AGATTTGTCTCTAAGATGTTCCATCCAAATGTCTATGCAGATGGTAGTATATGTCTGGACATACTTCAGA
  ACCGTTGGAGTCCAACCTATGATGTGTCTTCCATTCTAACATCCATACAGTCTCTGTTGGATGAACCCAA
  TCCCAATAGTCCAGCAAACAGCCAGGCTGCTCAGCTGTACCAGGAGAACAAACGGGAATATGAAAAGCGT
  GTTTCTGCAATAGTAGAACAAAGCTGGCGTGATTGT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC204194 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTV
  RFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR
  VSAIVEQSWRDC
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_003336
• ORF Size: 456 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_003336.4
• RefSeq Size: 1878 bp
• RefSeq ORF: 459 bp
• Locus ID: 7319
• UniProt ID: P49459
• Cytogenetics: Xq24
• Domains: UBCc
• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis
• MW: 17.3 kDa
• Gene Summary: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair, and may play a role in transcriptional regulation. Mutations in this gene are associated with cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]