GNB1L (NM_053004) Human Tagged ORF Clone

CAT#: RC204086

GNB1L (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), beta polypeptide 1-like (GNB1L)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_053004" in other vectors (6)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-GNB1L Antibody
    • 100 ul

USD 485.00

Other products for "GNB1L"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GNB1L
Synonyms DGCRK3; FKSG1; GY2; WDR14; WDVCF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204086 representing NM_053004
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGGCCCCCTGCCCGCCGCCACCTCCAGACCCCCAGTTTGTCCTCCGAGGCACCCAGTCACCGGTGC
ATGCGCTGCACTTCTGCGAAGGAGCCCAGGCTCAGGGGCGCCCGCTCCTCTTCTCAGGGTCTCAGAGTGG
CCTGGTACACATCTGGAGCCTGCAGACGCGGAGAGCGGTTACCACCCTGGATGGCCACGGCGGCCAGTGT
GTGACCTGGCTGCAGACGCTGCCCCAGGGGCGCCAGCTCCTCAGTCAGGGCCGGGACCTGAAGCTGTGCC
TGTGGGACCTCGCGGAGGGCAGGAGCGCTGTCGTGGACTCCGTGTGCTTGGAGAGTGTGGGCTTCTGCCG
GAGCAGCATCCTGGCCGGGGGCCAGCCACGCTGGACGCTTGCCGTGCCAGGGAGGGGCAGCGACGAGGTT
CAGATTCTGGAGATGCCCTCCAAGACGTCAGTGTGCGCCCTGAAGCCGAAGGCAGATGCCAAGCTGGGCA
TGCCCATGTGCCTGCGGCTGTGGCAGGCCGACTGCAGCTCCCGCCCACTCCTTCTGGCCGGCTATGAGGA
TGGATCGGTGGTCCTGTGGGACGTCTCTGAGCAGAAGGTGTGCAGCCGCATCGCCTGCCATGAGGAGCCC
GTCATGGACCTTGACTTTGACTCCCAGAAGGCCAGGGGCATCTCAGGCTCCGCGGGGAAGGCGCTGGCTG
TCTGGAGCCTGGACTGGCAGCAGGCCCTGCAGGTGCGTGGGACTCATGAACTCACCAATCCCGGGATCGC
CGAGGTCACGATCCGGCCAGATCGCAAGATCCTGGCCACCGCAGGCTGGGACCACCGCATCCGCGTGTTC
CACTGGCGGACGATGCAGCCACTGGCCGTGCTGGCCTTCCACAGCGCCGCTGTCCAGTGCGTGGCCTTCA
CCGCCGATGGCTTGCTGGCCGCGGGCTCCAAGGATCAGCGGATCAGCCTCTGGTCACTCTACCCACGCGC
A


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204086 representing NM_053004
Red=Cloning site Green=Tags(s)

MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAVTTLDGHGGQC
VTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEV
QILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSEQKVCSRIACHEEP
VMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVF
HWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_053004
ORF Size 981 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_053004.3
RefSeq Size 1537 bp
RefSeq ORF 984 bp
Locus ID 54584
UniProt ID Q9BYB4
Cytogenetics 22q11.21
Domains WD40
Protein Families Druggable Genome
MW 35.4 kDa
Gene Summary This gene encodes a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. The gene maps to the region on chromosome 22q11, which is deleted in DiGeorge syndrome, trisomic in derivative 22 syndrome and tetrasomic in cat-eye syndrome. Therefore, this gene may contribute to the etiology of those disorders. Transcripts from this gene share exons with some transcripts from the C22orf29 gene. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.