POP1 (NM_015029) Human Tagged ORF Clone

CAT#: RC203861

Reviews ()
Write a review

POP1 (Myc-DDK-tagged)-Human processing of precursor 1, ribonuclease P/MRP subunit (S. cerevisiae) (POP1), transcript variant 3



  "NM_015029" in other vectors (5)

Reconstitution Protocol

USD 891.00

USD 1,337.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "POP1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol POP1
Synonyms ANXD2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203861 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAAATGCAAAAGAAAGAAAACACGCCAAGAAAATGAGAAACCAGCCTACCAATGTGACTCTGTCCT
CTGGCTTTGTGGCTGACAGAGGTGTAAAGCACCACAGTGGAGGTGAAAAACCTTTCCAAGCTCAAAAACA
AGAGCCTCATCCTGGAACTTCACGACAGCGGCAAACCAGAGTCAACCCCCATTCTCTGCCTGACCCTGAA
GTGAATGAGCAGTCTTCCTCCAAAGGGATGTTTAGAAAAAAGGGAGGATGGAAAGCAGGTCCCGAGGGCA
CGTCTCAGGAGATCCCCAAGTATATAACTGCTTCTACTTTTGCTCAAGCACGAGCTGCTGAAATCAGTGC
TATGTTAAAAGCTGTGACCCAGAAGTCTTCGAATTCACTGGTTTTTCAGACTCTGCCACGGCACATGCGA
CGAAGAGCCATGAGCCACAACGTCAAACGCCTTCCCAGACGGTTACAGGAGATTGCCCAGAAAGAGGCGG
AGAAAGCCGTACATCAGAAAAAAGAACATTCAAAAAATAAATGCCATAAAGCTCGAAGATGTCACATGAA
CCGGACGCTAGAATTTAACCGTAGACAAAAGAAGAACATTTGGTTAGAAACTCACATCTGGCACGCCAAG
CGGTTTCATATGGTCAAGAAGTGGGGCTACTGCCTTGGGGAGAGGCCAACAGTCAAGAGCCACAGAGCCT
GCTATCGAGCCATGACGAACCGGTGCCTCCTGCAGGATTTATCCTATTACTGTTGTTTGGAGTTGAAAGG
CAAAGAGGAAGAAATACTAAAGGCGCTTTCTGGAATGTGTAACATAGACACAGGGCTGACGTTTGCAGCA
GTTCACTGCTTGTCTGGAAAGCGCCAAGGGAGCCTTGTGCTTTATCGGGTGAATAAATATCCCAGAGAAA
TGCTTGGGCCTGTTACGTTTATCTGGAAGTCCCAGAGGACCCCGGGTGACCCTTCTGAGAGCAGGCAGCT
GTGGATCTGGCTGCATCCAACCCTTAAACAGGATATCTTAGAGGAAATAAAAGCAGCGTGCCAGTGTGTG
GAACCCATCAAATCAGCTGTCTGCATCGCTGACCCACTTCCAACACCATCCCAAGAAAAAAGCCAAACTG
AATTGCCTGACGAGAAAATTGGCAAGAAAAGAAAAAGGAAAGATGATGGAGAAAATGCTAAACCAATTAA
AAAAATTATCGGTGATGGAACTAGAGATCCATGTCTACCATACTCTTGGATCTCTCCAACCACAGGCATT
ATAATCAGCGATTTGACGATGGAGATGAACAGATTCCGGCTGATTGGGCCACTTTCCCACTCCATCCTAA
CTGAAGCAATAAAAGCTGCTTCTGTCCACACTGTGGGAGAGGACACAGAGGAGACACCTCACCGCTGGTG
GATAGAAACCTGTAAGAAACCTGACAGCGTTTCCCTTCATTGCAGACAAGAAGCCATTTTCGAGTTGTTG
GGAGGAATAACATCACCAGCAGAAATTCCGGCAGGTACTATTCTGGGACTGACAGTTGGGGATCCTCGAA
TAAATTTGCCCCAAAAGAAGTCCAACGCTTTGCCCAATCCAGAAAAATGCCAAGATAATGAGAAAGTTAG
ACAGCTGCTTCTGGAGGGTGTGCCTGTGGAATGTACGCATAGCTTTATCTGGAACCAAGATATCTGTAAG
AGTGTCACAGAGAATAAAATCTCGGATCAGGATTTAAACCGGATGAGGAGTGAATTGCTGGTGCCTGGGT
CACAGCTTATTTTAGGTCCCCATGAATCCAAGATACCTATACTTTTGATTCAGCAGCCAGGAAAAGTGAC
TGGTGAAGATCGACTAGGCTGGGGAAGTGGCTGGGATGTCCTACTCCCAAAGGGCTGGGGCATGGCTTTC
TGGATTCCATTTATTTATCGAGGTGTGAGAGTCGGAGGGTTGAAAGAGTCTGCAGTGCATTCTCAGTATA
AGAGGTCGCCTAATGTCCCAGGCGATTTTCCAGACTGCCCTGCCGGGATGCTGTTTGCGGAAGAGCAAGC
TAAGAATCTTCTTGAAAAGTACAAAAGACGCCCTCCTGCAAAACGGCCCAACTACGTTAAGCTTGGCACT
CTGGCACCTTTCTGCTGTCCCTGGGAGCAGTTAACTCAAGACTGGGAGTCAAGAGTCCAGGCTTACGAAG
AACCTTCTGTAGCTTCATCTCCAAATGGTAAGGAGAGTGACCTAAGAAGATCTGAGGTGCCTTGTGCTCC
CATGCCTAAAAAAACTCATCAGCCATCTGATGAAGTGGGCACATCCATAGAGCACCCCAGGGAGGCAGAG
GAGGTAATGGATGCAGGGTGTCAAGAATCGGCAGGGCCTGAGAGGATCACAGACCAGGAGGCCAGTGAAA
ACCATGTTGCTGCCACAGGGAGTCACCTCTGCGTTCTCAGGAGTAGAAAATTACTGAAGCAACTGTCAGC
CTGGTGTGGGCCCAGTTCTGAGGATAGTCGGGGAGGCCGGCGAGCTCCCGGCAGAGGCCAGCAAGGATTG
ACCAGAGAGGCTTGCCTGTCCATCTTGGGCCACTTCCCCAGGGCCCTGGTTTGGGTCAGCCTGTCCCTGC
TCAGCAAGGGCAGCCCCGAGCCTCACACCATGATCTGTGTCCCAGCCAAGGAGGACTTCCTCCAGCTCCA
TGAGGACTGGCATTACTGTGGGCCCCAGGAATCCAAACACAGTGACCCATTCAGGAGCAAGATCCTGAAA
CAGAAAGAGAAGAAGAAAAGGGAGAAGAGGCAGAAGCCAGGACGTGCCTCTTCTGATGGCCCGGCGGGGG
AAGAGCCCGTGGCTGGGCAGGAAGCTCTGACTCTAGGGCTGTGGTCAGGCCCTCTGCCGCGTGTGACGTT
GCACTGCTCCAGAACTCTCCTAGGCTTTGTGACTCAGGGAGATTTTTCCATGGCTGTTGGCTGTGGAGAA
GCCCTGGGGTTTGTTAGCTTGACAGGCTTGCTGGATATGGTGTCCAGCCAGCCTGCAGCGCAGAGGGGCT
TAGTGCTACTGAGGCCTCCCGCCTCTCTGCAGTATCGATTTGCGAGGATTGCTATTGAGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203861 protein sequence
Red=Cloning site Green=Tags(s)

MSNAKERKHAKKMRNQPTNVTLSSGFVADRGVKHHSGGEKPFQAQKQEPHPGTSRQRQTRVNPHSLPDPE
VNEQSSSKGMFRKKGGWKAGPEGTSQEIPKYITASTFAQARAAEISAMLKAVTQKSSNSLVFQTLPRHMR
RRAMSHNVKRLPRRLQEIAQKEAEKAVHQKKEHSKNKCHKARRCHMNRTLEFNRRQKKNIWLETHIWHAK
RFHMVKKWGYCLGERPTVKSHRACYRAMTNRCLLQDLSYYCCLELKGKEEEILKALSGMCNIDTGLTFAA
VHCLSGKRQGSLVLYRVNKYPREMLGPVTFIWKSQRTPGDPSESRQLWIWLHPTLKQDILEEIKAACQCV
EPIKSAVCIADPLPTPSQEKSQTELPDEKIGKKRKRKDDGENAKPIKKIIGDGTRDPCLPYSWISPTTGI
IISDLTMEMNRFRLIGPLSHSILTEAIKAASVHTVGEDTEETPHRWWIETCKKPDSVSLHCRQEAIFELL
GGITSPAEIPAGTILGLTVGDPRINLPQKKSNALPNPEKCQDNEKVRQLLLEGVPVECTHSFIWNQDICK
SVTENKISDQDLNRMRSELLVPGSQLILGPHESKIPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAF
WIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRRPPAKRPNYVKLGT
LAPFCCPWEQLTQDWESRVQAYEEPSVASSPNGKESDLRRSEVPCAPMPKKTHQPSDEVGTSIEHPREAE
EVMDAGCQESAGPERITDQEASENHVAATGSHLCVLRSRKLLKQLSAWCGPSSEDSRGGRRAPGRGQQGL
TREACLSILGHFPRALVWVSLSLLSKGSPEPHTMICVPAKEDFLQLHEDWHYCGPQESKHSDPFRSKILK
QKEKKKREKRQKPGRASSDGPAGEEPVAGQEALTLGLWSGPLPRVTLHCSRTLLGFVTQGDFSMAVGCGE
ALGFVSLTGLLDMVSSQPAAQRGLVLLRPPASLQYRFARIAIEV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015029
ORF Size 3072 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015029.1, NP_055844.1
RefSeq Size 4689 bp
RefSeq ORF 3075 bp
Locus ID 10940
UniProt ID Q99575
Cytogenetics 8q22.2
Protein Families Stem cell - Pluripotency
MW 114.7 kDa
Gene Summary This gene encodes the protein subunit of two different small nucleolar ribonucleoprotein complexes: the endoribonuclease for mitochondrial RNA processing complex and the ribonuclease P complex. The encoded protein is a ribonuclease that localizes to the nucleus and functions in pre-RNA processing. This protein is also an autoantigen in patients suffering from connective tissue diseases. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2009]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.