SIAH Interacting Protein (CACYBP) (NM_014412) Human Tagged ORF Clone

CAT#: RC203302

CACYBP (Myc-DDK-tagged)-Human calcyclin binding protein (CACYBP), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_014412" in other vectors (4)

Reconstitution Protocol

Get a free Anti-DDK antibody sample free with this product. Use code: "DDK-Clone". View details »

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal antibody to CacyBP (calcyclin binding protein)
    • 100 ul

USD 533.00

Other products for "SIAH Interacting Protein"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SIAH Interacting Protein
Synonyms GIG5; PNAS-107; S100A6BP; SIP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203302 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCAGAAGAGCTACAGAAAGATCTAGAAGAGGTAAAGGTGTTGCTGGAAAAGGCTACTAGGAAAA
GAGTACGTGATGCCCTTACAGCTGAAAAATCCAAGATTGAGACAGAAATCAAGAACAAGATGCAACAGAA
ATCACAGAAGAAAGCAGAACTTCTTGATAATGAAAAACCAGCTGCTGTGGTTGCTCCCATTACAACGGGC
TATACGGTGAAAATCAGTAATTATGGATGGGATCAGTCAGATAAGTTTGTGAAAATCTACATTACCTTAA
CTGGAGTTCATCAAGTTCCCACTGAGAATGTGCAGGTGCATTTCACAGAGAGGTCATTTGATCTTTTGGT
AAAGAATCTAAATGGGAAGAGTTACTCCATGATTGTGAACAATCTCTTGAAACCCATCTCTGTGGAAGGC
AGTTCAAAAAAAGTCAAGACTGATACAGTTCTTATATTGTGTAGAAAGAAAGTGGAAAACACAAGGTGGG
ATTACCTGACCCAGGTTGAAAAGGAGTGCAAAGAAAAAGAGAAGCCCTCCTATGACACTGAAACAGATCC
TAGTGAGGGATTGATGAATGTTCTAAAGAAAATTTATGAAGATGGAGACGATGATATGAAGCGAACCATT
AATAAAGCCTGGGTGGAATCAAGAGAGAAGCAAGCCAAAGGAGACACGGAATTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203302 protein sequence
Red=Cloning site Green=Tags(s)

MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITTG
YTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNLNGKSYSMIVNNLLKPISVEG
SSKKVKTDTVLILCRKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTI
NKAWVESREKQAKGDTEF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014412
ORF Size 684 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014412.3
RefSeq Size 3060 bp
RefSeq ORF 687 bp
Locus ID 27101
UniProt ID Q9HB71
Cytogenetics 1q25.1
Domains SGS
Protein Pathways Wnt signaling pathway
MW 26.2 kDa
Gene Summary The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.