HTR1D (NM_000864) Human Tagged ORF Clone

CAT#: RC202862

HTR1D (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 1D (HTR1D)

Change vector?

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HTR1D (NM_000864) Human Tagged ORF Clone
Symbol HTR1D
Synonyms 5-HT1D; HT1DA; HTR1DA; HTRL; RDC4
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC202862 representing NM_000864
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCCACTGAACCAGTCAGCAGAAGGCCTTCCCCAGGAGGCCTCCAACAGATCCCTGAATGCCACAG
AAACCTCAGAGGCTTGGGATCCCAGGACCCTCCAGGCGCTCAAGATCTCCCTTGCCGTGGTCCTTTCCGT
CATCACACTGGCCACAGTCCTCTCCAATGCCTTTGTACTCACCACCATCTTACTCACCAGGAAGCTCCAC
ACCCCTGCCAACTACCTGATTGGCTCCCTGGCCACCACCGACCTCTTGGTTTCCATCTTGGTAATGCCCA
TCAGCATCGCCTATACCATCACCCACACCTGGAACTTTGGCCAAATCTTGTGTGACATCTGGCTGTCCTC
TGACATCACGTGCTGCACAGCCTCCATCCTGCATCTCTGTGTCATTGCTCTGGACAGGTACTGGGCAATC
ACAGATGCCCTGGAATACAGTAAACGCAGGACGGCTGGCCACGCGGCCACCATGATCGCCATTGTCTGGG
CCATCTCCATCTGCATCTCCATCCCCCCGCTCTTCTGGCGGCAGGCCAAGGCCCAGGAGGAGATGTCGGA
CTGTCTGGTGAACACCTCTCAGATTTCCTACACCATCTACTCCACCTGTGGGGCCTTCTACATTCCCTCG
GTGTTGCTCATCATCCTATATGGCCGGATCTACCGGGCTGCCCGGAACCGCATCCTGAATCCACCCTCAC
TCTATGGGAAGCGCTTCACCACGGCCCACCTCATCACAGGCTCTGCCGGGTCCTCGCTCTGCTCGCTCAA
CTCCAGCCTCCATGAGGGGCACTCGCACTCGGCTGGCTCCCCTCTCTTTTTCAACCACGTGAAAATCAAG
CTTGCTGACAGTGCCCTGGAACGCAAGAGGATTTCTGCTGCTCGAGAAAGGAAAGCCACTAAAATCCTGG
GCATCATTCTGGGGGCCTTTATCATCTGCTGGCTGCCCTTCTTCGTGGTGTCTCTGGTCCTCCCCATCTG
CCGGGACTCCTGCTGGATCCACCCGGCGCTCTTTGACTTCTTCACCTGGCTAGGCTATTTAAACTCCCTC
ATCAATCCAATAATCTACACTGTGTTTAATGAAGAGTTTCGGCAAGCTTTTCAGAAAATTGTCCCTTTCC
GGAAGGCCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202862 representing NM_000864
Red=Cloning site Green=Tags(s)

MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVLTTILLTRKLH
TPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAI
TDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIYSTCGAFYIPS
VLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIK
LADSALERKRISAARERKATKILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSL
INPIIYTVFNEEFRQAFQKIVPFRKAS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000864
ORF Size 1131 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000864.1, NM_000864.2, NM_000864.3, NM_000864.4, NP_000855
RefSeq Size 2855
Locus ID 3352
Cytogenetics 1p36.12
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 41.7 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.